(data stored in ACNUC9435 zone)

EMBL: AM180355.RPLK

AM180355.RPLK        Location/Qualifiers
FT   CDS             86164..86589
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="CD630_00610"
FT                   /old_locus_tag="CD0061"
FT                   /product="50S ribosomal protein L11"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66876"
FT                   /db_xref="GOA:Q18CE5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CE5"
FT                   /protein_id="CAJ66876.1"
FT                   /translation="MAKKVIGQIKLQIPAGKATPAPPVGPALGQHGVNIMGFTKEFNAK
FT                   TADQAGMIIPVVITVYQDRSFSFITKTPPAAVLIKKALNLKSGSGEPNKKKVAKMTSAQ
FT                   VREIAELKMPDLNAASVEAAMSMIAGTARSMGVVIED"
     MAKKVIGQIK LQIPAGKATP APPVGPALGQ HGVNIMGFTK EFNAKTADQA GMIIPVVITV        60
     YQDRSFSFIT KTPPAAVLIK KALNLKSGSG EPNKKKVAKM TSAQVREIAE LKMPDLNAAS       120
     VEAAMSMIAG TARSMGVVIE D                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page