(data stored in ACNUC9435 zone)

EMBL: AM180355.RPLV

AM180355.RPLV        Location/Qualifiers
FT   CDS             105664..105999
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="CD630_00780"
FT                   /old_locus_tag="CD0078"
FT                   /product="50S ribosomal protein L22"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66893"
FT                   /db_xref="GOA:Q18CG1"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CG1"
FT                   /protein_id="CAJ66893.1"
FT                   /translation="MEAKATAKYVRVSPRKAGQICDLVRGKNVDEALAILKFTPRGAAS
FT                   IIAKVVKSAKANAENNHEMDTEKLYIASIVANQGPTMKRFMPRAMGRATTIRKRTSHIE
FT                   VVVKEKK"
     MEAKATAKYV RVSPRKAGQI CDLVRGKNVD EALAILKFTP RGAASIIAKV VKSAKANAEN        60
     NHEMDTEKLY IASIVANQGP TMKRFMPRAM GRATTIRKRT SHIEVVVKEK K                111
//

If you have problems or comments...

PBIL Back to PBIL home page