(data stored in ACNUC9435 zone)

EMBL: AM180355.RPMD

AM180355.RPMD        Location/Qualifiers
FT   CDS             111238..111423
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="CD630_00881"
FT                   /old_locus_tag="CD0088A"
FT                   /product="50S ribosomal protein L30"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00881"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66906"
FT                   /db_xref="GOA:Q18CH8"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CH8"
FT                   /protein_id="CAJ66906.1"
FT                   /translation="MAKLQIKLVRSVIGTTPNQKKNVEALGLRKREQVVVKEDNAQTRG
FT                   MINKVSHLLEVTEIAE"
     MAKLQIKLVR SVIGTTPNQK KNVEALGLRK REQVVVKEDN AQTRGMINKV SHLLEVTEIA        60
     E                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page