(data stored in ACNUC9435 zone)

EMBL: AM180355.RPSC

AM180355.RPSC        Location/Qualifiers
FT   CDS             106022..106837
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="CD630_00790"
FT                   /old_locus_tag="CD0079"
FT                   /product="30S ribosomal protein S3"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66894"
FT                   /db_xref="GOA:Q18CG5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CG5"
FT                   /protein_id="CAJ66894.1"
FT                   /translation="MGQKVNPHGLRVGVIKDWDSRWFATDKKEFGNLLLEDHNIRKFLK
FT                   KRLYSAGVAKIEIERSANKIKMDLHVAKPGVVIGRAGAGIEALKAELEKMTKKTIIVNI
FT                   VEVRSTDKNAQLVAENIALAIERRVAFRRAMKQAIQRAMKSGAKGIKVSASGRLGGAEM
FT                   ARTEGYSEGNVPLQTLRADIDYGFAEADTTYGKIGIKVWICNGEVLPTRDGVNPREESR
FT                   KSDRRDNKRDNRRNDRRGNDRRGNDNRGNYRGQRPQGGSRPQRTENKGN"
     MGQKVNPHGL RVGVIKDWDS RWFATDKKEF GNLLLEDHNI RKFLKKRLYS AGVAKIEIER        60
     SANKIKMDLH VAKPGVVIGR AGAGIEALKA ELEKMTKKTI IVNIVEVRST DKNAQLVAEN       120
     IALAIERRVA FRRAMKQAIQ RAMKSGAKGI KVSASGRLGG AEMARTEGYS EGNVPLQTLR       180
     ADIDYGFAEA DTTYGKIGIK VWICNGEVLP TRDGVNPREE SRKSDRRDNK RDNRRNDRRG       240
     NDRRGNDNRG NYRGQRPQGG SRPQRTENKG N                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page