(data stored in ACNUC9435 zone)

EMBL: AM180355.RPSG

AM180355.RPSG        Location/Qualifiers
FT   CDS             98238..98708
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="CD630_00690"
FT                   /old_locus_tag="CD0069"
FT                   /product="30S ribosomal protein S7"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66884"
FT                   /db_xref="GOA:Q18CF5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CF5"
FT                   /protein_id="CAJ66884.1"
FT                   /translation="MPRKGNIPKREVLPDPMYGSKVVTKLINNLMVDGKKGKSQRIVYD
FT                   AFAIVAEKTGEEALEVFNKAMDNIMPVLEVKARRVGGANYQVPIEVRPERRQTLGLRWL
FT                   VKYTRARGEKGMVEKLAKEIMDAANNTGASVKKKEDTHKMAEANKAFAHYRW"
     MPRKGNIPKR EVLPDPMYGS KVVTKLINNL MVDGKKGKSQ RIVYDAFAIV AEKTGEEALE        60
     VFNKAMDNIM PVLEVKARRV GGANYQVPIE VRPERRQTLG LRWLVKYTRA RGEKGMVEKL       120
     AKEIMDAANN TGASVKKKED THKMAEANKA FAHYRW                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page