(data stored in ACNUC9435 zone)

EMBL: AM180355.RPSL

AM180355.RPSL        Location/Qualifiers
FT   CDS             97692..98114
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="CD630_00680"
FT                   /old_locus_tag="CD0068"
FT                   /product="30S ribosomal protein S12"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66883"
FT                   /db_xref="GOA:Q18CF2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CF2"
FT                   /protein_id="CAJ66883.2"
FT                   /translation="MPTINQLVRKSRKALEKKSTAPALQKGYNSLNKKVTDASAPQKRG
FT                   VCTSVKTVTPRKPNSALRKVARVRLTNGIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHILRGTLDTAGVDKRRQSRSKYGAKRPKEAKK"
     MPTINQLVRK SRKALEKKST APALQKGYNS LNKKVTDASA PQKRGVCTSV KTVTPRKPNS        60
     ALRKVARVRL TNGIEVSAYI PGEGHNLQEH SVVLIRGGRV KDLPGVRYHI LRGTLDTAGV       120
     DKRRQSRSKY GAKRPKEAKK                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page