(data stored in ACNUC9435 zone)

EMBL: AM180355.SPAK

AM180355.SPAK        Location/Qualifiers
FT   CDS             570187..571611
FT                   /transl_table=11
FT                   /gene="spaK"
FT                   /locus_tag="CD630_04820"
FT                   /old_locus_tag="CD0482"
FT                   /product="Two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67311"
FT                   /db_xref="GOA:Q188S3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q188S3"
FT                   /protein_id="CAJ67311.1"
FT                   /translation="MKNQSLITQFRHTFIFIIIASIVATVITYVFALYLYIHSLNKDIY
FT                   PPNYYERQVPRIEKYINEKNITLLSQSNEEGLKRTIRGDDMLYQVVDNNGNILYGTNPK
FT                   KLFKTKEELFNNFINKTVRKGGYIHTVPIKGDNGKIEGAVILFYQVKITFANIRGRFVF
FT                   AVIIMALFSPFLYIVGFTRWLSKRFVKNINQPLHLLIDASKKIKEKDLDFEIDYYSDNE
FT                   LGKLCSAFSEMKDELKGSLSAQWKMEQERVEMVEALAHDLKSPLSIILGYTDALIGNNT
FT                   DDNEKLHRYLTVIRENTEKSAALVQKMQYTSDLEKSNIQLNLVPINLPEFLRQKVQDYE
FT                   LQAHQKEVELILKMQGNIQSPIQIDVDRLTRIFDNIISNSLQYTPSGGNISITVKDEKN
FT                   CISYEICDSGRGFSSKDLKKALDKFYRGDEARQTKGGHSGLGLYIVKQLVEQLGGSVKI
FT                   ENSKSGGACVKFWHSI"
     MKNQSLITQF RHTFIFIIIA SIVATVITYV FALYLYIHSL NKDIYPPNYY ERQVPRIEKY        60
     INEKNITLLS QSNEEGLKRT IRGDDMLYQV VDNNGNILYG TNPKKLFKTK EELFNNFINK       120
     TVRKGGYIHT VPIKGDNGKI EGAVILFYQV KITFANIRGR FVFAVIIMAL FSPFLYIVGF       180
     TRWLSKRFVK NINQPLHLLI DASKKIKEKD LDFEIDYYSD NELGKLCSAF SEMKDELKGS       240
     LSAQWKMEQE RVEMVEALAH DLKSPLSIIL GYTDALIGNN TDDNEKLHRY LTVIRENTEK       300
     SAALVQKMQY TSDLEKSNIQ LNLVPINLPE FLRQKVQDYE LQAHQKEVEL ILKMQGNIQS       360
     PIQIDVDRLT RIFDNIISNS LQYTPSGGNI SITVKDEKNC ISYEICDSGR GFSSKDLKKA       420
     LDKFYRGDEA RQTKGGHSGL GLYIVKQLVE QLGGSVKIEN SKSGGACVKF WHSI             474
//

If you have problems or comments...

PBIL Back to PBIL home page