(data stored in SCRATCH zone)

EMBL: AM269952.PE1

AM269952.PE1         Location/Qualifiers
FT   CDS             <3..617
FT                   /locus_tag="An01g00740"
FT                   /product="hypothetical protein [truncated ORF]"
FT                   /note="Remark: N-terminally truncated due to contig
FT                   border."
FT                   /db_xref="GOA:A2Q7H6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H6"
FT                   /protein_id="CAK43452.1"
FT                   /translation="NTIALLSQTLTVILDIVEVGSSIGLYTVTGVFATVLPVLGAVLAV
FT                   LGVVMMLINLFVNLFGGSPPPDPVQEFIDHVAKGLVGGFENAPPPKLDYTIPSVIYESG
FT                   EVTGITIKGENTTNDEISIPNARIVVNSGSDDVCLFSTDDFELVEDTDTDKDSDKHLYV
FT                   TPNSTAEGTLSSSVLGDETEYHEFDLVVGGKKRIRRTVCTN"
     NTIALLSQTL TVILDIVEVG SSIGLYTVTG VFATVLPVLG AVLAVLGVVM MLINLFVNLF        60
     GGSPPPDPVQ EFIDHVAKGL VGGFENAPPP KLDYTIPSVI YESGEVTGIT IKGENTTNDE       120
     ISIPNARIVV NSGSDDVCLF STDDFELVED TDTDKDSDKH LYVTPNSTAE GTLSSSVLGD       180
     ETEYHEFDLV VGGKKRIRRT VCTN                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page