(data stored in SCRATCH zone)

EMBL: AM269952.PE11

AM269952.PE11        Location/Qualifiers
FT   CDS             complement(join(17952..18032,18195..18421,18512..18601,
FT                   18680..18814,18907..19000))
FT                   /locus_tag="An01g00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7I6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I6"
FT                   /protein_id="CAK43462.1"
FT                   /translation="MPRELHRGRITQGNGRTVKSSLAKRQQHEGGRPTAKKPFRAIVGI
FT                   RCWLTRSVHPLARVSAMVLTPNFPAKEPVEDDPGYYPGNSIREPLASLVVASFDQRDAF
FT                   GSGSYCNPKCPVALPYGGLVGDLGKSGNNQRHGEQKRNRPDPRGGVTPHVPELSVVVNV
FT                   SHCGFGVMNTIPAPDLAIEKELTVQMTLDRGHILVRRCLGPQTPL"
     MPRELHRGRI TQGNGRTVKS SLAKRQQHEG GRPTAKKPFR AIVGIRCWLT RSVHPLARVS        60
     AMVLTPNFPA KEPVEDDPGY YPGNSIREPL ASLVVASFDQ RDAFGSGSYC NPKCPVALPY       120
     GGLVGDLGKS GNNQRHGEQK RNRPDPRGGV TPHVPELSVV VNVSHCGFGV MNTIPAPDLA       180
     IEKELTVQMT LDRGHILVRR CLGPQTPL                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page