(data stored in SCRATCH zone)

EMBL: AM269952.PE13

AM269952.PE13        Location/Qualifiers
FT   CDS             complement(join(21417..23135,23194..23272))
FT                   /exception="reasons given in citation"
FT                   /locus_tag="An01g00860"
FT                   /note="Catalytic activity: DHGO is an enzyme catalyzing the
FT                   stereospecific phenol oxidative coupling reaction
FT                   converting dihydrogeodin to (+)- geodin."
FT                   /note="Remark: a putative frameshift results in an
FT                   premature STOP codon."
FT                   /note="Similarity: DHGO shows significant homology with
FT                   multicopper blue proteins such as laccase and ascorbate
FT                   oxidase."
FT                   /note="Title: strong similarity to dihydrogeodin oxidase
FT                   DHGO - Aspergillus terreus [putative frameshift]"
FT                   /note="putative frameshift"
FT                   /note="See PMID 7665560"
FT                   /db_xref="GOA:A2Q7I8"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I8"
FT                   /inference="profile:COGS:COG2132"
FT                   /inference="profile:PFAM:PF00394"
FT                   /inference="similar to AA sequence:UniProtKB:ATDHGO.1"
FT                   /protein_id="CAK43464.1"
FT                   /translation="MVYWQSWFLLLGTVASFNPLESLLPDGLSPYGLLPTYHLDPFLKS
FT                   GSNNNQYQHSNLEHPPWKDISPSGGPPDTGVTRHYNFTITRDITAPDGYQKSGILINGQ
FT                   FPGPLIEANWGDMISVTVNNMITTETAEGLTLHWHGLTQAKSPWEDGVPGITQCPIAPG
FT                   GSFTYTFQADQYGTSWYHSHYSAQYTDGAYGPMIIHGPVQPEASYDYDLGPVIISDYSH
FT                   LSYFEVLENIFSIPPVFPNVDNNLINGRGAYNCNSSSTTTCSPASSLARFNFHSGKTHR
FT                   LRLMNTGSNANQKFTIDGHNMTVIANDFVPVQPYTTDVVTLGVGQRTDIIVTXTGNPTE
FT                   SYWMRASIDMTCLNATASIPTVKAAIYYEDADTQPGQPPRPPQPGRATTVPTIPSTSPS
FT                   PTTFKHPPPPPPPPRPWKSPXAKTLPXTPYSTSTTXTFRSDYNTPLLLLGKAGNFSDPD
FT                   PDLNVYNFGSNSSVRLIIYNLFSMQHPLHLHGHNYWVLAQGRGTWDGVVTNPKNPQRRD
FT                   THIIQPGTEDSPAYVVLEWQANNPGVWPLHCHMSWHVSVGLLLNVVVSCFPSFLPSFLS
FT                   FVLSVGVDANVDLISCGTGTAR"
     MVYWQSWFLL LGTVASFNPL ESLLPDGLSP YGLLPTYHLD PFLKSGSNNN QYQHSNLEHP        60
     PWKDISPSGG PPDTGVTRHY NFTITRDITA PDGYQKSGIL INGQFPGPLI EANWGDMISV       120
     TVNNMITTET AEGLTLHWHG LTQAKSPWED GVPGITQCPI APGGSFTYTF QADQYGTSWY       180
     HSHYSAQYTD GAYGPMIIHG PVQPEASYDY DLGPVIISDY SHLSYFEVLE NIFSIPPVFP       240
     NVDNNLINGR GAYNCNSSST TTCSPASSLA RFNFHSGKTH RLRLMNTGSN ANQKFTIDGH       300
     NMTVIANDFV PVQPYTTDVV TLGVGQRTDI IVTXTGNPTE SYWMRASIDM TCLNATASIP       360
     TVKAAIYYED ADTATWPTTT TTTTWSSNNC ANDPLNLTIP YYLQTPPSTP ATTQTMEITX       420
     GENATXHTLF YVNNXHLPLR LQHPAPPPRQ SRQLLRPGPR PERLQLRLEL LRPSHHLQSL       480
     LHAAPASSPR SQLLGASPGK RDLGWSRHXS EESSASXYPH HPAGHGGXSR VCGARMAGEX       540
     SRRLASSLSY VLACXCRVAF ECGCKLFPLL PSFLSXFRAL CWGGCXCGFD FLRNRNGQM        599
//

If you have problems or comments...

PBIL Back to PBIL home page