(data stored in SCRATCH zone)

EMBL: AM269952.PE14

AM269952.PE14        Location/Qualifiers
FT   CDS             complement(24088..25107)
FT                   /locus_tag="An01g00870"
FT                   /note="Catalytic activity: COQ2 catalyzes the transfer of
FT                   the polyisoprenoid side chain to para-hydroxybenzoate
FT                   (PHB)."
FT                   /note="Pathway: COQ2 catalyzes a step in the biosynthesis
FT                   of the lipid-soluble electron carrier Coenzyme Q."
FT                   /note="Remark: The amino acid sequence of COQ2 exhibits a
FT                   typical amino-terminal mitochondrial leader sequence and
FT                   six potential membrane-spanning domains."
FT                   /note="Title: strong similarity to para-hydroxybenzoate
FT                   polyprenyltransferase Coq2 - Saccharomyces cerevisiae"
FT                   /note="See PMID 1740455"
FT                   /db_xref="GOA:A2Q7I9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I9"
FT                   /inference="profile:COGS:COG0382"
FT                   /inference="profile:PFAM:PF01040"
FT                   /inference="similar to AA sequence:PIR:S20056"
FT                   /protein_id="CAK43465.1"
FT                   /translation="METLTQRQTVHKVAITAHHEGVKAQTQPPVTNEMPIQGVAKLVPS
FT                   SWVPYVQLMRLDRPGFLGFFMPTLMGLSAGATLADPPIAPLDFFKSFLFFWFVTNFIRG
FT                   AACTWNDNLDQEFDRQVPRTRCRPIARGAVSTTQGHIFTLAQVAITAWILSHLPAQCHA
FT                   YSLAMGVLHAIYPLCKRFMDFTPVFLGLPFSVTMILPAVGMGVDPFSAPAACLFMVEFI
FT                   WTIIYETIYAHQDVQHDVQAGVKSMAVRYRHSTKIIASVLGVVMVGLMVAVGVLAGLSG
FT                   IYFLVGCGGTALSLVVMIYSVDLTKPASCLYWFRMGFYIVGGSKSAGFLAQYLVDLLG"
     METLTQRQTV HKVAITAHHE GVKAQTQPPV TNEMPIQGVA KLVPSSWVPY VQLMRLDRPG        60
     FLGFFMPTLM GLSAGATLAD PPIAPLDFFK SFLFFWFVTN FIRGAACTWN DNLDQEFDRQ       120
     VPRTRCRPIA RGAVSTTQGH IFTLAQVAIT AWILSHLPAQ CHAYSLAMGV LHAIYPLCKR       180
     FMDFTPVFLG LPFSVTMILP AVGMGVDPFS APAACLFMVE FIWTIIYETI YAHQDVQHDV       240
     QAGVKSMAVR YRHSTKIIAS VLGVVMVGLM VAVGVLAGLS GIYFLVGCGG TALSLVVMIY       300
     SVDLTKPASC LYWFRMGFYI VGGSKSAGFL AQYLVDLLG                              339
//

If you have problems or comments...

PBIL Back to PBIL home page