(data stored in SCRATCH zone)

EMBL: AM269952.PE15

AM269952.PE15        Location/Qualifiers
FT   CDS             complement(join(26247..26560,26616..27055,27123..27246,
FT                   27301..27427,27486..27626))
FT                   /locus_tag="An01g00880"
FT                   /note="Catalytic activity: 6-OMT catalyzes the transfer of
FT                   the S-methyl group of S-adenosyl-L-methionine to the
FT                   6-hydroxyl group of
FT                   1,2,3,4-tetrahydro-1-[(4-hydroxyphenyl)methyl]-6,7-isoquin
FT                   olinediol (norcoclaurine)."
FT                   /note="Pathway: 6-OMT catalyzes an early step in the
FT                   biosynthetic pathway to reticuline, an important
FT                   intermediate in synthesizing isoquinoline alkaloids."
FT                   /note="Title: strong similarity to
FT                   S-adenosyl-L-methionine:norcoclaurine 6-O-methyltransferase
FT                   6-OMT - Coptis japonica"
FT                   /note="See PMID 7925429"
FT                   /note="See PMID 10811648"
FT                   /db_xref="GOA:A2Q7J0"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J0"
FT                   /inference="profile:COGS:COG0500"
FT                   /inference="profile:PFAM:PF00891"
FT                   /protein_id="CAK43466.1"
FT                   /translation="MEALVEEVRRQAKSGDEKTRKDILDSLSKLYASIETPDDTVQRFT
FT                   FYNMQLACIRTAIDLKLFELLNQADGPLTVDQLSKRTGANPVFMGRLLRYLASYHAVQE
FT                   VAQDTFTASNISKTFSQRGFQAAVGHLFNNAGPSIQDLPAFLKENGYPDIQDNVKTPFQ
FT                   KVMNTELPAFLWLQQHPENLAFFNEHMKTNRFGMPTFLDVFPALEKAGGLSAERALFVD
FT                   IGGGFGQQAISFREKYSQLEGRVIVQDLAPTTANATQHPGVEFMAYDFFTPQPVKGAKF
FT                   YYLRNIFHDWPDHKCLEILQNIKDAMAPDSYILIDDMVLPNVGVHWQQAQLDMLMMAAL
FT                   GARERTQEQWNKLLQSAGLKINKVHTYTESLKDSIIEAVAA"
     MEALVEEVRR QAKSGDEKTR KDILDSLSKL YASIETPDDT VQRFTFYNMQ LACIRTAIDL        60
     KLFELLNQAD GPLTVDQLSK RTGANPVFMG RLLRYLASYH AVQEVAQDTF TASNISKTFS       120
     QRGFQAAVGH LFNNAGPSIQ DLPAFLKENG YPDIQDNVKT PFQKVMNTEL PAFLWLQQHP       180
     ENLAFFNEHM KTNRFGMPTF LDVFPALEKA GGLSAERALF VDIGGGFGQQ AISFREKYSQ       240
     LEGRVIVQDL APTTANATQH PGVEFMAYDF FTPQPVKGAK FYYLRNIFHD WPDHKCLEIL       300
     QNIKDAMAPD SYILIDDMVL PNVGVHWQQA QLDMLMMAAL GARERTQEQW NKLLQSAGLK       360
     INKVHTYTES LKDSIIEAVA A                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page