(data stored in SCRATCH zone)

EMBL: AM269952.PE16

AM269952.PE16        Location/Qualifiers
FT   CDS             join(28653..28817,28888..29263,29329..29458,29521..29588,
FT                   29659..29993)
FT                   /locus_tag="An01g00890"
FT                   /note="Title: weak similarity to integral membrane protein
FT                   PTH11 - Magnaporthe grisea"
FT                   /db_xref="GOA:A2Q7J1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J1"
FT                   /protein_id="CAK43467.1"
FT                   /translation="MSAPPAGGDQNRGPALVAIYWAEASFAILAVALRLYGRKLINGFG
FT                   ADDYMMVFTLILFITLAAFVTYLADQGGCRHLYYLTTDQQLLVVKFNWITQVWGIFGFA
FT                   TGKSSVALQIMRILGPNDNWMKWLLWFLMVSTTIFCGLDCLFGFVQCDPPRALWEPWIP
FT                   HTCWNTNVQANFAIFISALPTAWNVLVDLVLAALPIPIIWRTSLTLKQRIATCTLLGLG
FT                   PLAAAFGLVKIQYLAGLKERSDLTWQTYNLYVWSGSELFVIIICGCVPPMRPIFTNLFG
FT                   RKSQFTGYYESSSGYKRRHNYKLSTLGSSQPVQSQDEDTEALHSRVEGTGSHLPQSRFS
FT                   ENAIYREVNISIENGPK"
     MSAPPAGGDQ NRGPALVAIY WAEASFAILA VALRLYGRKL INGFGADDYM MVFTLILFIT        60
     LAAFVTYLAD QGGCRHLYYL TTDQQLLVVK FNWITQVWGI FGFATGKSSV ALQIMRILGP       120
     NDNWMKWLLW FLMVSTTIFC GLDCLFGFVQ CDPPRALWEP WIPHTCWNTN VQANFAIFIS       180
     ALPTAWNVLV DLVLAALPIP IIWRTSLTLK QRIATCTLLG LGPLAAAFGL VKIQYLAGLK       240
     ERSDLTWQTY NLYVWSGSEL FVIIICGCVP PMRPIFTNLF GRKSQFTGYY ESSSGYKRRH       300
     NYKLSTLGSS QPVQSQDEDT EALHSRVEGT GSHLPQSRFS ENAIYREVNI SIENGPK          357
//

If you have problems or comments...

PBIL Back to PBIL home page