(data stored in SCRATCH zone)

EMBL: AM269952.PE17

AM269952.PE17        Location/Qualifiers
FT   CDS             complement(join(30933..31465,31832..31991,32096..32361,
FT                   32482..32678,32737..32757,32806..33507,33561..34251,
FT                   34314..34557))
FT                   /locus_tag="An01g00900"
FT                   /note="Catalytic activity: Protein tyrosine phosphate +
FT                   H(2)O = protein tyrosine + phosphate."
FT                   /note="Function: pyp2+ encodes a nonreceptor type protein
FT                   tyrosine phosphatase that negatively regulates mitosis."
FT                   /note="Title: similarity to protein-tyrosine-phosphatase
FT                   pyp2p - Schizosaccharomyces pombe"
FT                   /note="See PMID 1448087"
FT                   /note="See PMID 1464319"
FT                   /db_xref="GOA:A2Q7J2"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J2"
FT                   /inference="profile:COGS:COG5599"
FT                   /inference="profile:PFAM:PF00102"
FT                   /inference="similar to AA sequence:PIR:T45160"
FT                   /protein_id="CAK43468.1"
FT                   /translation="MAIASRAAECAQLFDKYARTLDGDELLKQDMENEIFRFNLWAANN
FT                   FILTPGRASMDWRLRNAPLLQSTMAELLDDLKADLINQSNFPFNSTIPTGMLYELPLHA
FT                   VSETLDGLFRLSRAIRRSGILRRYVKVGNYVEFDENGVNLTEAFRNGVKTLIEFRMKES
FT                   KSSNGLRERIINTVCLRQQYFSYLKAKKATNAPISGADQSHQSTPRSALRATASVTGSL
FT                   TSKAQGAARQQSSPMRRPGPSIMTATTAQPDRIPKAYSVKSAHEQQTYDVDCNDADIPP
FT                   PPNVSGNRKESECPYCFLACSKEELSGRRWKHHIIQDLMPYICVLEPCPTPNSLFESGK
FT                   DWLSHMKNQHPVSGWTCVDSTHDTTFFFQSESGFREHLHQYHEDQFDDDDIDDIATACY
FT                   QKLPDDIIIRECPFCPTVQKLELKPKDMINHVANHLISLAQISLAGHIDDGRSQSAWSG
FT                   SSRDSSSLPASIGSLPERLHSEFRDDDETEYLASISGEVIPDADEELIYALWQKVQKPQ
FT                   DDPSLDLTLRHFIAQSGMQAKVTTEGAVVGSNDLDTGQSSEKEQATAPELDRSSEDSAG
FT                   VLQDTAREGSLKIVEMFDEEGNPRLFDEITDDVPPFLCQSDSEIYDKFEELEWEERVRL
FT                   NEGMLTNDPAHPYALEQDPEVSARNRYDNVQAWANSRIHLRVPEGECDFINASPIILRD
FT                   SVTQEERTYIATQAPIIGYLSHFWHMVFHESKDVAVIVMLTQTFEAGREKCAQYFPLHL
FT                   DQASMFLESTFDVKSRSEIRKLELTIGSETKIVWHFLFAGWPEYSKPEGDDCEALLELI
FT                   RLSASKSGPQNPRVVHCSSGVGRTGTFIALEHLLQELESGQLLQLADPEADPVFDTVNQ
FT                   MREQRMMMVYNVKQFQFIYDVLREQTDIKLGKVRPRNNGSLGSQMEEPRPAKLAKIGDQ
FT                   ANKVPAS"
     MAIASRAAEC AQLFDKYART LDGDELLKQD MENEIFRFNL WAANNFILTP GRASMDWRLR        60
     NAPLLQSTMA ELLDDLKADL INQSNFPFNS TIPTGMLYEL PLHAVSETLD GLFRLSRAIR       120
     RSGILRRYVK VGNYVEFDEN GVNLTEAFRN GVKTLIEFRM KESKSSNGLR ERIINTVCLR       180
     QQYFSYLKAK KATNAPISGA DQSHQSTPRS ALRATASVTG SLTSKAQGAA RQQSSPMRRP       240
     GPSIMTATTA QPDRIPKAYS VKSAHEQQTY DVDCNDADIP PPPNVSGNRK ESECPYCFLA       300
     CSKEELSGRR WKHHIIQDLM PYICVLEPCP TPNSLFESGK DWLSHMKNQH PVSGWTCVDS       360
     THDTTFFFQS ESGFREHLHQ YHEDQFDDDD IDDIATACYQ KLPDDIIIRE CPFCPTVQKL       420
     ELKPKDMINH VANHLISLAQ ISLAGHIDDG RSQSAWSGSS RDSSSLPASI GSLPERLHSE       480
     FRDDDETEYL ASISGEVIPD ADEELIYALW QKVQKPQDDP SLDLTLRHFI AQSGMQAKVT       540
     TEGAVVGSND LDTGQSSEKE QATAPELDRS SEDSAGVLQD TAREGSLKIV EMFDEEGNPR       600
     LFDEITDDVP PFLCQSDSEI YDKFEELEWE ERVRLNEGML TNDPAHPYAL EQDPEVSARN       660
     RYDNVQAWAN SRIHLRVPEG ECDFINASPI ILRDSVTQEE RTYIATQAPI IGYLSHFWHM       720
     VFHESKDVAV IVMLTQTFEA GREKCAQYFP LHLDQASMFL ESTFDVKSRS EIRKLELTIG       780
     SETKIVWHFL FAGWPEYSKP EGDDCEALLE LIRLSASKSG PQNPRVVHCS SGVGRTGTFI       840
     ALEHLLQELE SGQLLQLADP EADPVFDTVN QMREQRMMMV YNVKQFQFIY DVLREQTDIK       900
     LGKVRPRNNG SLGSQMEEPR PAKLAKIGDQ ANKVPAS                                937
//

If you have problems or comments...

PBIL Back to PBIL home page