(data stored in SCRATCH zone)

EMBL: AM269952.PE18

AM269952.PE18        Location/Qualifiers
FT   CDS             join(34893..35728,35780..37813,37896..37959,38230..38295)
FT                   /locus_tag="An01g00910"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   CAD21096.1 - Neurospora crassa"
FT                   /db_xref="GOA:A2Q7J3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J3"
FT                   /inference="profile:COGS:COG0775"
FT                   /inference="similar to AA sequence:UniProtKB:NCB8L21.11"
FT                   /protein_id="CAK43469.1"
FT                   /translation="MAHRSADIDLVCLVSDVITALGGTFRHSPRLYRDLKVSLAIMALE
FT                   IHNVDISVALSEEPNLRRTFENMAEALDRAFRKDFVNTKYQQLKAGEETQPPRLSKWWP
FT                   RLFTSWTDSPKVYMKNWTQTSYPYLGLVSELLQSSLQRELRIGELIIDDYRVIRDLTNL
FT                   ANKLVEQLDRGQSFDDDEDFTEKAQPNPSISEAAIRGETSIHYLSQNLYHTLHENWPCQ
FT                   LEGHEHGRKLGHCVEAKFCLDPQWSSRDPDPSRDSFFILLAGSDIIQECRVRWLPTDVM
FT                   IETNTLACLVDHEASKDVCLQLAKDDNNRLWGLELGQPLEVLQLAEECTGRSLESLRKL
FT                   LEIVKPTYAAKRVLGLTLARSLLHLLEGPWVSSYLSIDDIFIFCKVQNGYPYPLFDKVF
FT                   LSTAFKTIDSECGPQASRRPPYSIHPFPTILALGIALAEMELGDELHDIYGQPSFAGLR
FT                   NKPSRLAKKLWEECERRFHLGTGLMRTVRFCTDQTSFLRFADMGKETVFTDSEFVDVYC
FT                   KNAIRPLEEDLVNGAKWTWDEVNRLQRRDLVDQGVCKIIKLKIDPPSNEISERMRNTEP
FT                   KWSKPPGHVSSLVTIPEANGSVEYSQQNLSSDETLRINDKASHCQPSDTQEPVRPKTRD
FT                   GFDVAIICALPIEADAVLSAFDHHWDKELYGKATNDPNFYSVGVMRGRNVVLVHPPRSG
FT                   KAPAANVATACAMSFTKVTLALIVGVCGGVPFKHNKEEILLGDVVISKGVIQYDHGRQY
FT                   SDGFKRKIEMEAALGRPNPQIGSVLAALETQFHRENAQHKITAFLDNLDDDVTSYPGHV
FT                   EDRLFPSWYRHKHHNHQVCRVCADCWNNDDSVCDIAPELNCQATGCEDIRIVKRHRQNQ
FT                   RNQPFVHVGLIASGDSVLKSATHRDQIAENENVIAFEMEGAGAWDALPCVVIKGVCDYA
FT                   DSHKNKLWQKYAAITAAACAREFIQHCSLGITKMALITKYKRPIETRELDLYFRCVPRL
FT                   TEIKPSNNKT"
     MAHRSADIDL VCLVSDVITA LGGTFRHSPR LYRDLKVSLA IMALEIHNVD ISVALSEEPN        60
     LRRTFENMAE ALDRAFRKDF VNTKYQQLKA GEETQPPRLS KWWPRLFTSW TDSPKVYMKN       120
     WTQTSYPYLG LVSELLQSSL QRELRIGELI IDDYRVIRDL TNLANKLVEQ LDRGQSFDDD       180
     EDFTEKAQPN PSISEAAIRG ETSIHYLSQN LYHTLHENWP CQLEGHEHGR KLGHCVEAKF       240
     CLDPQWSSRD PDPSRDSFFI LLAGSDIIQE CRVRWLPTDV MIETNTLACL VDHEASKDVC       300
     LQLAKDDNNR LWGLELGQPL EVLQLAEECT GRSLESLRKL LEIVKPTYAA KRVLGLTLAR       360
     SLLHLLEGPW VSSYLSIDDI FIFCKVQNGY PYPLFDKVFL STAFKTIDSE CGPQASRRPP       420
     YSIHPFPTIL ALGIALAEME LGDELHDIYG QPSFAGLRNK PSRLAKKLWE ECERRFHLGT       480
     GLMRTVRFCT DQTSFLRFAD MGKETVFTDS EFVDVYCKNA IRPLEEDLVN GAKWTWDEVN       540
     RLQRRDLVDQ GVCKIIKLKI DPPSNEISER MRNTEPKWSK PPGHVSSLVT IPEANGSVEY       600
     SQQNLSSDET LRINDKASHC QPSDTQEPVR PKTRDGFDVA IICALPIEAD AVLSAFDHHW       660
     DKELYGKATN DPNFYSVGVM RGRNVVLVHP PRSGKAPAAN VATACAMSFT KVTLALIVGV       720
     CGGVPFKHNK EEILLGDVVI SKGVIQYDHG RQYSDGFKRK IEMEAALGRP NPQIGSVLAA       780
     LETQFHRENA QHKITAFLDN LDDDVTSYPG HVEDRLFPSW YRHKHHNHQV CRVCADCWNN       840
     DDSVCDIAPE LNCQATGCED IRIVKRHRQN QRNQPFVHVG LIASGDSVLK SATHRDQIAE       900
     NENVIAFEME GAGAWDALPC VVIKGVCDYA DSHKNKLWQK YAAITAAACA REFIQHCSLG       960
     ITKMALITKY KRPIETRELD LYFRCVPRLT EIKPSNNKT                              999
//

If you have problems or comments...

PBIL Back to PBIL home page