(data stored in SCRATCH zone)

EMBL: AM269952.PE19

AM269952.PE19        Location/Qualifiers
FT   CDS             39069..39824
FT                   /locus_tag="An01g00920"
FT                   /note="Title: strong similarity to hypothetical lysogenic
FT                   protein CAD54907.1 - Bacteriophage P2-EC58"
FT                   /db_xref="GOA:A2Q7J4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J4"
FT                   /protein_id="CAK43470.1"
FT                   /translation="MSAGITAIVTLHSDRLKRHSESEKLVAEYRDPLLLASMELQSRLY
FT                   NILEQDFLCYYENKARRDLVDVYTAFLIGQFFSWTYILRRQVQFLRFSSNKSNQKLSRA
FT                   IEAIQKSFSTDMYGKDDSDFMLWRGEQLAIGEIMTVSDDGELFCLQYSQFIQKFKSADA
FT                   PFKDYFNPITEGITALVNRRSTHHPSQHLPAGRLRRVQHFILDLIDVLDPHYLGKASAR
FT                   SQRVYSAPCCDCSECRREAGSYGTDSGTS"
     MSAGITAIVT LHSDRLKRHS ESEKLVAEYR DPLLLASMEL QSRLYNILEQ DFLCYYENKA        60
     RRDLVDVYTA FLIGQFFSWT YILRRQVQFL RFSSNKSNQK LSRAIEAIQK SFSTDMYGKD       120
     DSDFMLWRGE QLAIGEIMTV SDDGELFCLQ YSQFIQKFKS ADAPFKDYFN PITEGITALV       180
     NRRSTHHPSQ HLPAGRLRRV QHFILDLIDV LDPHYLGKAS ARSQRVYSAP CCDCSECRRE       240
     AGSYGTDSGT S                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page