(data stored in SCRATCH zone)

EMBL: AM269952.PE2

AM269952.PE2         Location/Qualifiers
FT   CDS             join(3206..3432,3501..3519)
FT                   /locus_tag="An01g00750"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q7H7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H7"
FT                   /protein_id="CAK43453.1"
FT                   /translation="MTIPYPLIGPESYGLGSKQARRNRSTCSTPRSVDSIVVDAAFAKE
FT                   IQSTNASQEHLDSCASSNKSEKKWKARFSRKFFHFP"
     MTIPYPLIGP ESYGLGSKQA RRNRSTCSTP RSVDSIVVDA AFAKEIQSTN ASQEHLDSCA        60
     SSNKSEKKWK ARFSRKFFHF P                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page