(data stored in SCRATCH zone)

EMBL: AM269952.PE20

AM269952.PE20        Location/Qualifiers
FT   CDS             join(41231..41713,41848..42207)
FT                   /locus_tag="An01g00930"
FT                   /note="Catalytic activity: Methyl chloride transferase
FT                   catalyzes the synthesis of methyl chloride from
FT                   S-adenosine-L-methionine and chloride ion."
FT                   /note="Title: similarity to methyl chloride transferase
FT                   AAC72357.1 - Batis maritima"
FT                   /note="See PMID 9789006"
FT                   /db_xref="GOA:A2Q7J5"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J5"
FT                   /inference="profile:COGS:COG0500"
FT                   /inference="similar to AA sequence:UniProtKB:AF084829.1"
FT                   /protein_id="CAK43471.1"
FT                   /translation="MTTPTDNKFKDAQAYLAKHQGDSYLKGWDLLWDKGDYLPWDRGFP
FT                   NPALEDTLVERAGTIGGPIGPDGKRRKVLVPGCGRGVDVLLFASFGYDAYGLECSAAAV
FT                   EACKKEEEKVNNIQYRVRDEKVGKGKITFVQGDFFDDAWLKEIGVPRNGFDVIYDYTFF
FT                   CALNPELRPKWALRHTELLAPFPAGNLICLESPRHRDPLAPGPPFASPSEAYMEHLSHP
FT                   GEEISYNDKGLVDADPLREPSKAGLERVAYWQPERTHTVGKDKNGVIQDRVSIWRRRD"
     MTTPTDNKFK DAQAYLAKHQ GDSYLKGWDL LWDKGDYLPW DRGFPNPALE DTLVERAGTI        60
     GGPIGPDGKR RKVLVPGCGR GVDVLLFASF GYDAYGLECS AAAVEACKKE EEKVNNIQYR       120
     VRDEKVGKGK ITFVQGDFFD DAWLKEIGVP RNGFDVIYDY TFFCALNPEL RPKWALRHTE       180
     LLAPFPAGNL ICLESPRHRD PLAPGPPFAS PSEAYMEHLS HPGEEISYND KGLVDADPLR       240
     EPSKAGLERV AYWQPERTHT VGKDKNGVIQ DRVSIWRRRD                             280
//

If you have problems or comments...

PBIL Back to PBIL home page