(data stored in SCRATCH zone)

EMBL: AM269952.PE22

AM269952.PE22        Location/Qualifiers
FT   CDS             join(44185..44281,44335..44630,44763..44782,44830..44968,
FT                   45164..45172,45222..45304,45342..45369,45636..45684,
FT                   45956..46084,46247..46620)
FT                   /locus_tag="An01g00950"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   encoded by An11g07790 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q7J7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J7"
FT                   /protein_id="CAK43473.1"
FT                   /translation="MSSFTQPVPVVACGRIPTMGKSISQHLLPEYQVIHFILSYEAAEA
FT                   ELPHLLAGRDPQSRSPNEIGTHDYSQPPRAVIFGRGYEPQQVEELKKKFAGVPKEPVAW
FT                   VRGNPADLPAGAAGPEYAQNVAADMKKGRYQGYLTFRTIRTRVNLPRPRTRSLFRQIGK
FT                   TLELYTPPRKMDRKLYKGCLLEIVLVRLSELGTLNSIQSMFTLIHQSHGNESDTVSSSS
FT                   QNVANVAISYGQNEWLEIPLGEGETNRVGDHTTQLDAEAEAEMTAKMQHRKIQNRKNQR
FT                   ARRQRGSIRRRNRHVQLPCTVSRSRLTPLTITVSDPKPTWALPRCEGDDEGEVTAGHKG
FT                   LIVWGEPYDMQNWEATPGFLAKWSWAVDGCHDLVECSNRWRRMRGEEPIRLAESLEGSR
FT                   PWRCRLAT"
     MSSFTQPVPV VACGRIPTMG KSISQHLLPE YQVIHFILSY EAAEAELPHL LAGRDPQSRS        60
     PNEIGTHDYS QPPRAVIFGR GYEPQQVEEL KKKFAGVPKE PVAWVRGNPA DLPAGAAGPE       120
     YAQNVAADMK KGRYQGYLTF RTIRTRVNLP RPRTRSLFRQ IGKTLELYTP PRKMDRKLYK       180
     GCLLEIVLVR LSELGTLNSI QSMFTLIHQS HGNESDTVSS SSQNVANVAI SYGQNEWLEI       240
     PLGEGETNRV GDHTTQLDAE AEAEMTAKMQ HRKIQNRKNQ RARRQRGSIR RRNRHVQLPC       300
     TVSRSRLTPL TITVSDPKPT WALPRCEGDD EGEVTAGHKG LIVWGEPYDM QNWEATPGFL       360
     AKWSWAVDGC HDLVECSNRW RRMRGEEPIR LAESLEGSRP WRCRLAT                     407
//

If you have problems or comments...

PBIL Back to PBIL home page