(data stored in SCRATCH zone)

EMBL: AM269952.PE23

AM269952.PE23        Location/Qualifiers
FT   CDS             complement(47046..48044)
FT                   /locus_tag="An01g00960"
FT                   /note="Title: strong similarity to hypothetical
FT                   oxidoreductase DR2595 - Deinococcus radiodurans"
FT                   /db_xref="GOA:A2Q7J8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J8"
FT                   /inference="profile:COGS:COG1028"
FT                   /inference="profile:PFAM:PF00106"
FT                   /inference="similar to AA sequence:PIR:H75255"
FT                   /protein_id="CAK43474.1"
FT                   /translation="MSRYAEAHAKPNGPGDARPTALEIIKDEGVEGKLKGEVIVITGTS
FT                   SGIGIETTRALATTGATLFLTARDVTKAQSALAGIFEPSRMKIIEMDQASLSSVRIAAA
FT                   AILAETSKIHLLVNNAGIMAIPDLRLTADGHELQFCTNYLSHFLFYKLLEPALLAAASA
FT                   DLPSRVVNLASSAHNVHGINDTDNYNFQKGGYDPSVAYGQSKTANIYMANEIERRYGSR
FT                   HLHSTSVHPGLVQTGLAQHMPPDAFKGMGHLYPIMKSVEQGAATSVWGAVGKAWKHEGG
FT                   KYLVDCAVAEPYAEGDDKFTAPGYSPYAYDVEKAKRLWIDSLELVGLRDEE"
     MSRYAEAHAK PNGPGDARPT ALEIIKDEGV EGKLKGEVIV ITGTSSGIGI ETTRALATTG        60
     ATLFLTARDV TKAQSALAGI FEPSRMKIIE MDQASLSSVR IAAAAILAET SKIHLLVNNA       120
     GIMAIPDLRL TADGHELQFC TNYLSHFLFY KLLEPALLAA ASADLPSRVV NLASSAHNVH       180
     GINDTDNYNF QKGGYDPSVA YGQSKTANIY MANEIERRYG SRHLHSTSVH PGLVQTGLAQ       240
     HMPPDAFKGM GHLYPIMKSV EQGAATSVWG AVGKAWKHEG GKYLVDCAVA EPYAEGDDKF       300
     TAPGYSPYAY DVEKAKRLWI DSLELVGLRD EE                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page