(data stored in SCRATCH zone)

EMBL: AM269952.PE24

AM269952.PE24        Location/Qualifiers
FT   CDS             join(48793..49191,49249..49292,49769..49911,50154..50467)
FT                   /locus_tag="An01g00970"
FT                   /note="Title: similarity to hypothetical protein encoded by
FT                   An11g04000 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q7J9"
FT                   /db_xref="InterPro:IPR006642"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J9"
FT                   /protein_id="CAK43475.1"
FT                   /translation="MSSSMNLRQCIEATARAFLSAYEEGSVQNDASIINRNVTADCRRY
FT                   LLPSSVPHAFGLPADFFFDTAKYQEMFGKDIKVLKFTNNIMANLIIDTEARRAAFTSVA
FT                   EVHANNGETYPAEMAWFLYFNEDGSKVKKFGSEAYRMWRDIQTSLIERPTLAILRTIIP
FT                   MAVGPHRDPPIFHFRPEREILTFSTSIQPPVLSMVRCPICQEHVALSDINGHLDSGCQT
FT                   FIATQLQSPASSTLNETDCEQRESRAIAQGTTEQHHLKNNYNSTVPLDVDRNKKRSFNR
FT                   NPTPRARNQIRDYHRLSL"
     MSSSMNLRQC IEATARAFLS AYEEGSVQND ASIINRNVTA DCRRYLLPSS VPHAFGLPAD        60
     FFFDTAKYQE MFGKDIKVLK FTNNIMANLI IDTEARRAAF TSVAEVHANN GETYPAEMAW       120
     FLYFNEDGSK VKKFGSEAYR MWRDIQTSLI ERPTLAILRT IIPMAVGPHR DPPIFHFRPE       180
     REILTFSTSI QPPVLSMVRC PICQEHVALS DINGHLDSGC QTFIATQLQS PASSTLNETD       240
     CEQRESRAIA QGTTEQHHLK NNYNSTVPLD VDRNKKRSFN RNPTPRARNQ IRDYHRLSL        299
//

If you have problems or comments...

PBIL Back to PBIL home page