(data stored in SCRATCH zone)

EMBL: AM269952.PE25

AM269952.PE25        Location/Qualifiers
FT   CDS             complement(52389..52661)
FT                   /locus_tag="An01g00990"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   encoded by An01g12970 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q7K0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K0"
FT                   /protein_id="CAK43476.1"
FT                   /translation="MSRVIPKRDKKRPQDRNAQRATRQRTKDCLALLELQVSQLQGGAD
FT                   KALSDELRQMRKERDELGTLADDLVTIAEATKSALESSNNEAAQT"
     MSRVIPKRDK KRPQDRNAQR ATRQRTKDCL ALLELQVSQL QGGADKALSD ELRQMRKERD        60
     ELGTLADDLV TIAEATKSAL ESSNNEAAQT                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page