(data stored in SCRATCH zone)

EMBL: AM269952.PE26

AM269952.PE26        Location/Qualifiers
FT   CDS             complement(join(52846..53695,53731..53909,53966..54169))
FT                   /locus_tag="An01g01000"
FT                   /note="Title: similarity to hypothetical protein BAC11036.1
FT                   - Homo sapiens"
FT                   /db_xref="GOA:A2Q7K1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K1"
FT                   /inference="similar to AA sequence:UniProtKB:AK074519.1"
FT                   /protein_id="CAK43477.1"
FT                   /translation="MAAMMTPGSPVRLGPGPRRRSSNLVILLLVIIALLWSLVIHQNIG
FT                   RGLHVTLDDIRDPLDAIVNNTLGFEKIFAISPAQRLDRRDAIVLASSATGFHVDFIDGL
FT                   ILDEDSAKVRQPGTHDEYLAHDLCSCFPPACECCAEVASRVTYCSFTSSNKIYRIVADG
FT                   IASALILEDDVDWDINLKMQLKGLALGSQQIPKINAPERNATTDSPYGDSWDVLWIGHC
FT                   GMKCNSSSPVQVMPHDITAMPSRYLPPYLYDAPAGTGNNVRMSCIIEKAACSAAYAITY
FT                   GASQKILAALTRLTDDDNLDFPNLLSELCHNGSLECYSSYPSLVGRWKRGRREEYSSDN
FT                   DQEAVDRQMSHSSGVMYSTLGNIEHILGGECTVRASIDDAIVPELNPDLFEVPHSFLQW
FT                   TDKKGGHERAL"
     MAAMMTPGSP VRLGPGPRRR SSNLVILLLV IIALLWSLVI HQNIGRGLHV TLDDIRDPLD        60
     AIVNNTLGFE KIFAISPAQR LDRRDAIVLA SSATGFHVDF IDGLILDEDS AKVRQPGTHD       120
     EYLAHDLCSC FPPACECCAE VASRVTYCSF TSSNKIYRIV ADGIASALIL EDDVDWDINL       180
     KMQLKGLALG SQQIPKINAP ERNATTDSPY GDSWDVLWIG HCGMKCNSSS PVQVMPHDIT       240
     AMPSRYLPPY LYDAPAGTGN NVRMSCIIEK AACSAAYAIT YGASQKILAA LTRLTDDDNL       300
     DFPNLLSELC HNGSLECYSS YPSLVGRWKR GRREEYSSDN DQEAVDRQMS HSSGVMYSTL       360
     GNIEHILGGE CTVRASIDDA IVPELNPDLF EVPHSFLQWT DKKGGHERAL                  410
//

If you have problems or comments...

PBIL Back to PBIL home page