(data stored in SCRATCH zone)

EMBL: AM269952.PE27

AM269952.PE27        Location/Qualifiers
FT   CDS             complement(54791..56044)
FT                   /locus_tag="An01g01010"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   Y49E10.24 - Caenorhabditis elegans"
FT                   /db_xref="GOA:A2Q7K2"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K2"
FT                   /inference="similar to AA sequence:PIR:T27047"
FT                   /protein_id="CAK43478.1"
FT                   /translation="MPITVSLVNQQQCYAGNDRIRGRVIFQCPTPTEIQDIRVTFSGRA
FT                   KAKVQKTKGSAAPAASYRSKCILFEKERILWHPNGDTVAPDTYEWPFEFVFPSHAQAAS
FT                   SRWPETLPFRSDANHPLPPTFAAETHDSLRKLECTIEYRVHAQVFRPQRGILGRKSPLF
FT                   SEVVHLNFLPLEARWDLKSTDSYPATYQQQKEQLFNIRSMLLLPENKGRSLKVQEKIQS
FT                   WLSPGQLPRFSFKASFSYPTRMIQSAPIPCFLDITPFMEDSSVISPPDIVMQSLSIFMV
FT                   SQTAARAAPSLMGALSGQVDERIEILSRTSLGMRVLGKVDLAQAFGHLRIRHTDVSFRT
FT                   FNISRTYRLCASFSFECAGKTSTFDVPDLPVELLANSWEPEKATQSFEGHVAEDASPPP
FT                   YASASTLSTSSITTPEKS"
     MPITVSLVNQ QQCYAGNDRI RGRVIFQCPT PTEIQDIRVT FSGRAKAKVQ KTKGSAAPAA        60
     SYRSKCILFE KERILWHPNG DTVAPDTYEW PFEFVFPSHA QAASSRWPET LPFRSDANHP       120
     LPPTFAAETH DSLRKLECTI EYRVHAQVFR PQRGILGRKS PLFSEVVHLN FLPLEARWDL       180
     KSTDSYPATY QQQKEQLFNI RSMLLLPENK GRSLKVQEKI QSWLSPGQLP RFSFKASFSY       240
     PTRMIQSAPI PCFLDITPFM EDSSVISPPD IVMQSLSIFM VSQTAARAAP SLMGALSGQV       300
     DERIEILSRT SLGMRVLGKV DLAQAFGHLR IRHTDVSFRT FNISRTYRLC ASFSFECAGK       360
     TSTFDVPDLP VELLANSWEP EKATQSFEGH VAEDASPPPY ASASTLSTSS ITTPEKS          417
//

If you have problems or comments...

PBIL Back to PBIL home page