(data stored in SCRATCH zone)

EMBL: AM269952.PE29

AM269952.PE29        Location/Qualifiers
FT   CDS             complement(61565..62047)
FT                   /locus_tag="An01g01030"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   encoded by An16g05360 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q7K4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K4"
FT                   /protein_id="CAK43480.1"
FT                   /translation="MTHYPVYIIRTHLAMPGPDLPSPRYHTAIFVETDPVTGSGTIHEV
FT                   TGDITSPEGMYYESKLAPQPESVENFFSRTLLGMTDAAHYPNSWDNVLREIPAPPQQKA
FT                   FNVKRMKTEPFKRLSPLEFYEAGEERRPLVKCTEWVVDKAIPALRKAGLLQSSISA"
     MTHYPVYIIR THLAMPGPDL PSPRYHTAIF VETDPVTGSG TIHEVTGDIT SPEGMYYESK        60
     LAPQPESVEN FFSRTLLGMT DAAHYPNSWD NVLREIPAPP QQKAFNVKRM KTEPFKRLSP       120
     LEFYEAGEER RPLVKCTEWV VDKAIPALRK AGLLQSSISA                             160
//

If you have problems or comments...

PBIL Back to PBIL home page