(data stored in SCRATCH zone)

EMBL: AM269952.PE31

AM269952.PE31        Location/Qualifiers
FT   CDS             complement(join(65596..65889,65954..66558,66618..66750))
FT                   /locus_tag="An01g01050"
FT                   /note="Title: similarity to hypothetical protein YLR007w
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="GOA:A2Q7K6"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014857"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K6"
FT                   /inference="similar to AA sequence:PIR:S64829"
FT                   /protein_id="CAK43482.1"
FT                   /translation="MPRYAEDHDRYDDSNRAFLQAFMARSTMTFTQAKPVLAAIFSIRD
FT                   DEQVSPEDITEDDLQTYIAAANSAISPFDLEIRSILPQIEINNNNDPPPAPERVYALVN
FT                   TTSDALTQLATTYSADEIAFVKRILDAMFDTYNTRRQEAMVISSMQALQLAKAGAGDAN
FT                   RRESGTQQQATQGGAAQSLTMTQAETMLKQLVEQGWFEKSRKGYYRLSPRGLMELRGWL
FT                   VAAYNDEGIRKIKFCAACRDIITAGQRCGDRDCTGRLHDHCMRNFFRMQQAESCPVCKS
FT                   AWPGDRFVGERAITMSDPAAQRARRSAANTQQAEAGPSTQFTLPELDVEDEADGGEEEA
FT                   GSD"
     MPRYAEDHDR YDDSNRAFLQ AFMARSTMTF TQAKPVLAAI FSIRDDEQVS PEDITEDDLQ        60
     TYIAAANSAI SPFDLEIRSI LPQIEINNNN DPPPAPERVY ALVNTTSDAL TQLATTYSAD       120
     EIAFVKRILD AMFDTYNTRR QEAMVISSMQ ALQLAKAGAG DANRRESGTQ QQATQGGAAQ       180
     SLTMTQAETM LKQLVEQGWF EKSRKGYYRL SPRGLMELRG WLVAAYNDEG IRKIKFCAAC       240
     RDIITAGQRC GDRDCTGRLH DHCMRNFFRM QQAESCPVCK SAWPGDRFVG ERAITMSDPA       300
     AQRARRSAAN TQQAEAGPST QFTLPELDVE DEADGGEEEA GSD                         343
//

If you have problems or comments...

PBIL Back to PBIL home page