(data stored in SCRATCH zone)

EMBL: AM269952.PE32

AM269952.PE32        Location/Qualifiers
FT   CDS             complement(join(67275..67603,67683..67983))
FT                   /locus_tag="An01g01060"
FT                   /note="Complex: Forms a heterodimer with the spU2AF59 large
FT                   subunit."
FT                   /note="Function: spU2AF23 is the SNRNP auxiliary factor
FT                   small subunit which is necessary for the splicing of
FT                   pre-mRNA."
FT                   /note="Localization: Nuclear protein."
FT                   /note="Remark: Binds to the polypyrimidine tract of introns
FT                   early during spliceosome assembly."
FT                   /note="Title: strong similarity to splicing factor spU2AF23
FT                   - Schizosaccharomyces pombe"
FT                   /note="See PMID 8657565"
FT                   /db_xref="GOA:A2Q7K7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K7"
FT                   /inference="profile:PFAM:PF00642"
FT                   /inference="similar to AA sequence:PIR:T39243"
FT                   /protein_id="CAK43483.1"
FT                   /translation="MANYLASIFGTEQDKVNCSFYYKIGACRHGDRCSRKHVKPSYSQT
FT                   ILMPNMYQNPAYDPKSKMNPSQLQNHFDAFYEDVWCEMCKYGELEELVVCDNNNDHLIG
FT                   NVYARFKYEEDAQAACDALNSRWYAARPIYCELSPVTDFREACCRLNSGEGCVRGGFCN
FT                   FIHRKDPSNELDRDLRLSTKKWLKERGRDARSVSRSPSPEPTRRRY"
     MANYLASIFG TEQDKVNCSF YYKIGACRHG DRCSRKHVKP SYSQTILMPN MYQNPAYDPK        60
     SKMNPSQLQN HFDAFYEDVW CEMCKYGELE ELVVCDNNND HLIGNVYARF KYEEDAQAAC       120
     DALNSRWYAA RPIYCELSPV TDFREACCRL NSGEGCVRGG FCNFIHRKDP SNELDRDLRL       180
     STKKWLKERG RDARSVSRSP SPEPTRRRY                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page