(data stored in SCRATCH zone)

EMBL: AM269952.PE33

AM269952.PE33        Location/Qualifiers
FT   CDS             complement(join(68195..68280,68418..69244,69298..69752))
FT                   /locus_tag="An01g01070"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   BAB09014.1 - Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q7K8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K8"
FT                   /inference="profile:COGS:COG0665"
FT                   /protein_id="CAK43484.1"
FT                   /translation="MPTVILGGGIIGSSIAYYLSQSQPQEEIHVIESASELFCSASGYA
FT                   AGFLAKDWFAPSLAPLGELSFNLHESLAAEHGGRQKWGYMKGVALSLGSVSNKGGARGD
FT                   DWLRAGTSRAETAAGTSQYGEPQVPEWLTQQQGAKVEQISDKDTTGQVDPLRLCRFLMD
FT                   SCTSRGVKLHCPTKASSLVRNEAGTITGVRIVNLNTKSESTIPCTNLVVCAGPWTPQVF
FT                   RDLFPFSKVALPIYPLAGYSLVLHSPRHTLEHEQKKYHGETHALFTTWPPSCGFSPELF
FT                   SREGREIYIAGLNTKTIPLPERADDSHNSVDQKEMDRLKAASVRLLGKLAEGKTESSDE
FT                   TPNLNDLKIVREGLCFRPASDRGTPFVGRIDDSLLGEGIKTATGSRKGGVFVASGHGPW
FT                   GISLALGTGKVIADLVEGVQPAVDISGLAQKFTTKKELSKVHAEDGRLRHQKLLRD"
     MPTVILGGGI IGSSIAYYLS QSQPQEEIHV IESASELFCS ASGYAAGFLA KDWFAPSLAP        60
     LGELSFNLHE SLAAEHGGRQ KWGYMKGVAL SLGSVSNKGG ARGDDWLRAG TSRAETAAGT       120
     SQYGEPQVPE WLTQQQGAKV EQISDKDTTG QVDPLRLCRF LMDSCTSRGV KLHCPTKASS       180
     LVRNEAGTIT GVRIVNLNTK SESTIPCTNL VVCAGPWTPQ VFRDLFPFSK VALPIYPLAG       240
     YSLVLHSPRH TLEHEQKKYH GETHALFTTW PPSCGFSPEL FSREGREIYI AGLNTKTIPL       300
     PERADDSHNS VDQKEMDRLK AASVRLLGKL AEGKTESSDE TPNLNDLKIV REGLCFRPAS       360
     DRGTPFVGRI DDSLLGEGIK TATGSRKGGV FVASGHGPWG ISLALGTGKV IADLVEGVQP       420
     AVDISGLAQK FTTKKELSKV HAEDGRLRHQ KLLRD                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page