(data stored in SCRATCH zone)

EMBL: AM269952.PE34

AM269952.PE34        Location/Qualifiers
FT   CDS             join(71306..71342,71423..71736,71827..72197,72255..72291)
FT                   /locus_tag="An01g01080"
FT                   /note="Catalytic activity: 7,8-dihydrobiopterin + NADP(+) =
FT                   sepiapterin + NADPH."
FT                   /note="Pathway: Sepiapterin reductase SPR
FT                   (7,8-dihydrobiopterin: NADP+ oxidoreductase) catalyzes the
FT                   terminal step in the biosynthetic pathway for
FT                   tetrahydrobiopterin, the cofactor necessary for aromatic
FT                   amino acid hydroxylation."
FT                   /note="Title: strong similarity to sepiapterin reductase
FT                   SPR - Rattus norvegicus"
FT                   /note="See PMID 2201030"
FT                   /note="See PMID 2260974"
FT                   /db_xref="GOA:A2Q7K9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K9"
FT                   /inference="profile:COGS:COG1028"
FT                   /inference="profile:PFAM:PF00106"
FT                   /protein_id="CAK43485.1"
FT                   /translation="MSKTIIVTGASRGIGLAITKYLLTAPQSHNVVVIARSREPLEKLK
FT                   EQYSKQVEVLNGDLADFSIGQKAVDLALRSFGRLDGMVLNHGMLGQVGKVKDADFEQWK
FT                   HGFDVNFISLVAFIKAGLPALRESKGKIIFTSSGAAVSAYRGWALYGATKAAMNHLALS
FT                   LGEEEPEVTTISIRPGMVDTEMQRELREDHATTLEPQMHAKFTTVHKEGKLLKPEQPGH
FT                   VMAKLVLDAPNELTGKFFTWNDKALEAFQA"
     MSKTIIVTGA SRGIGLAITK YLLTAPQSHN VVVIARSREP LEKLKEQYSK QVEVLNGDLA        60
     DFSIGQKAVD LALRSFGRLD GMVLNHGMLG QVGKVKDADF EQWKHGFDVN FISLVAFIKA       120
     GLPALRESKG KIIFTSSGAA VSAYRGWALY GATKAAMNHL ALSLGEEEPE VTTISIRPGM       180
     VDTEMQRELR EDHATTLEPQ MHAKFTTVHK EGKLLKPEQP GHVMAKLVLD APNELTGKFF       240
     TWNDKALEAF QA                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page