(data stored in SCRATCH zone)

EMBL: AM269952.PE35

AM269952.PE35        Location/Qualifiers
FT   CDS             join(73098..73119,73188..73214,73367..73626,73692..73811)
FT                   /locus_tag="An01g01090"
FT                   /note="Complex: Dr1 directly interacts with the
FT                   TATA-binding protein (TBP) subunit of the multiprotein
FT                   TFIID complex."
FT                   /note="Function: Dr1 has a regulatory role in repression of
FT                   class II gene transcription that is mediated via
FT                   phosphorylation."
FT                   /note="Title: similarity to TATA-binding protein-associated
FT                   phosphoprotein Dr1 - Homo sapiens"
FT                   /note="See PMID 7958881"
FT                   /note="See PMID 1339312"
FT                   /db_xref="GOA:A2Q7L0"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR042225"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L0"
FT                   /inference="profile:COGS:COG5150"
FT                   /inference="profile:PFAM:PF00808"
FT                   /inference="similar to AA sequence:PIR:A43320"
FT                   /protein_id="CAK43486.1"
FT                   /translation="MSDREFSANDDLSLPKATVQKIITEILPPSSGQTFSKDARDLLME
FT                   CCVEFITLISSEANDISEKEAKKTIACEHVERALRDLGFSDYIPDVLAVAEEHKEQLKS
FT                   REKKQSKMEQSGLSEEELLRQQQELFRSATEKYHAAPE"
     MSDREFSAND DLSLPKATVQ KIITEILPPS SGQTFSKDAR DLLMECCVEF ITLISSEAND        60
     ISEKEAKKTI ACEHVERALR DLGFSDYIPD VLAVAEEHKE QLKSREKKQS KMEQSGLSEE       120
     ELLRQQQELF RSATEKYHAA PE                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page