(data stored in SCRATCH zone)

EMBL: AM269952.PE36

AM269952.PE36        Location/Qualifiers
FT   CDS             complement(join(75845..78784,78898..79464))
FT                   /locus_tag="An01g01110"
FT                   /EC_number="3.5.2.-"
FT                   /note="Function: Pseudomonas sp. hyuA is involved in the
FT                   conversion of D-5-substituted hydantoins to corresponding
FT                   N-carbamyl-D-amino acids."
FT                   /note="Title: strong similarity to D-amino acid hydantoin
FT                   hydrolase hyuA - Pseudomonas sp."
FT                   /note="See PMID 1732229"
FT                   /db_xref="GOA:A2Q7L1"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L1"
FT                   /inference="profile:COGS:COG0145"
FT                   /inference="profile:PFAM:PF01968"
FT                   /inference="profile:PFAM:PF05378"
FT                   /inference="similar to AA sequence:PIR:B42594"
FT                   /protein_id="CAK43487.1"
FT                   /translation="MASTNEFRLGVDVGGTFTDVCVFTPNGETVRAKVPTTPNQTIGIR
FT                   HGIAKVRRVLKERYNWDGTFRFIHHGTTTATNAVLEGKGARTALVVTAGHKDILAVRRS
FT                   QIPGGLGAWLYYTPPEPPVPLERVVQCAERMSVSGETVVEVDGERLKGDLLELMERERP
FT                   EAVAVSLLSSYKNPAHEEAVAKIIRENYLRELSEQLASETEAIRVLKSDGGLTSVGLAG
FT                   KFPVNILMSGPAGGAKGVADAVARSTPYKNLITLDMGGTSTDCALILDGKPRIRRDTVV
FT                   DTLTVRAPAVDIHTVGAGGGSIATYMELTETLRVGPESAGAAPGPACYGKGGTEATVTD
FT                   ANLVLGYLPHTLLDGEFCLDTEAAKTAIQKLATAMDLPLRQTAENIINIVNETMYGAVR
FT                   LVSVEQGYDPRDFALVAFGGAGPLHANAVGKLLGAWPVIVPPSPGILCAQGDLTTKLSH
FT                   EQSVTFTRLVRDTSSEELQRQVDELEKHCEQIMRESCGSDWPMPLVATYEVDVRYKGQA
FT                   LTITINLLPDEIQLDDQAWRCVLQDAFNKKHQQQFGYCLPDFELELMRIGVTLVDGSSD
FT                   VELPVVPKAESSEPTSSAVIGTQIIIIEGQEQVATVWEREKITLEGIRVTGPCIITEMD
FT                   SNTLILPGYSGEIDRLGNILIQPIAKQPSPTTQHTSDSAADLMHSNPLIATLVASSLAC
FT                   IRGEMDKLMLRCSMSPAIREQQDEFNVITTAEGKMLVGQFGSFIKEFLEVWTGSIEEGD
FT                   VFITNDTYMVKGAVSHLNDVIIILPIFHEHRLIGWASQFGHLTDVGGMVPGSLSINATS
FT                   IYDDGVQIPCIKLYSRGVMNSDLVDLLCRNSRQPAWYRSDLTALVTACRMAATRISELA
FT                   TRFGTEVYLAACQELLLRNRTGLAKIVERQFDDQLSTFTDFVDDDGHGVGPWAVTCSMQ
FT                   KTSAGGLKFDWSGTSPQSEHSINFYLSETMFKMLVGYYLIAAAAPGTVINNGFHDLIEV
FT                   RIPEGTVLKPVRPAAISCRTHFLGRTMDVIQALIGQKNEAYVAAAGFSDSPHFFYSGYY
FT                   PSGEWYQLYQIGFGGVPARAAGDGLDCHCLFPAIKSIPTESIELNYPLRIEANESVADS
FT                   GGPGYFRGGNAQRTLYRFLAKGEISLHDDRWFTNHGVSKGGSRDNVRGRSCIGILAVPI
FT                   VQ"
     MASTNEFRLG VDVGGTFTDV CVFTPNGETV RAKVPTTPNQ TIGIRHGIAK VRRVLKERYN        60
     WDGTFRFIHH GTTTATNAVL EGKGARTALV VTAGHKDILA VRRSQIPGGL GAWLYYTPPE       120
     PPVPLERVVQ CAERMSVSGE TVVEVDGERL KGDLLELMER ERPEAVAVSL LSSYKNPAHE       180
     EAVAKIIREN YLRELSEQLA SETEAIRVLK SDGGLTSVGL AGKFPVNILM SGPAGGAKGV       240
     ADAVARSTPY KNLITLDMGG TSTDCALILD GKPRIRRDTV VDTLTVRAPA VDIHTVGAGG       300
     GSIATYMELT ETLRVGPESA GAAPGPACYG KGGTEATVTD ANLVLGYLPH TLLDGEFCLD       360
     TEAAKTAIQK LATAMDLPLR QTAENIINIV NETMYGAVRL VSVEQGYDPR DFALVAFGGA       420
     GPLHANAVGK LLGAWPVIVP PSPGILCAQG DLTTKLSHEQ SVTFTRLVRD TSSEELQRQV       480
     DELEKHCEQI MRESCGSDWP MPLVATYEVD VRYKGQALTI TINLLPDEIQ LDDQAWRCVL       540
     QDAFNKKHQQ QFGYCLPDFE LELMRIGVTL VDGSSDVELP VVPKAESSEP TSSAVIGTQI       600
     IIIEGQEQVA TVWEREKITL EGIRVTGPCI ITEMDSNTLI LPGYSGEIDR LGNILIQPIA       660
     KQPSPTTQHT SDSAADLMHS NPLIATLVAS SLACIRGEMD KLMLRCSMSP AIREQQDEFN       720
     VITTAEGKML VGQFGSFIKE FLEVWTGSIE EGDVFITNDT YMVKGAVSHL NDVIIILPIF       780
     HEHRLIGWAS QFGHLTDVGG MVPGSLSINA TSIYDDGVQI PCIKLYSRGV MNSDLVDLLC       840
     RNSRQPAWYR SDLTALVTAC RMAATRISEL ATRFGTEVYL AACQELLLRN RTGLAKIVER       900
     QFDDQLSTFT DFVDDDGHGV GPWAVTCSMQ KTSAGGLKFD WSGTSPQSEH SINFYLSETM       960
     FKMLVGYYLI AAAAPGTVIN NGFHDLIEVR IPEGTVLKPV RPAAISCRTH FLGRTMDVIQ      1020
     ALIGQKNEAY VAAAGFSDSP HFFYSGYYPS GEWYQLYQIG FGGVPARAAG DGLDCHCLFP      1080
     AIKSIPTESI ELNYPLRIEA NESVADSGGP GYFRGGNAQR TLYRFLAKGE ISLHDDRWFT      1140
     NHGVSKGGSR DNVRGRSCIG ILAVPIVQ                                         1168
//

If you have problems or comments...

PBIL Back to PBIL home page