(data stored in SCRATCH zone)

EMBL: AM269952.PE37

AM269952.PE37        Location/Qualifiers
FT   CDS             join(80271..80390,80459..80560,81255..81606,81699..81775,
FT                   82374..82381,82531..82589,82668..82822,82859..82902,
FT                   82988..83100,83318..84316,84706..84761,84823..84938,
FT                   85016..85040)
FT                   /locus_tag="An01g01120"
FT                   /note="Title: similarity to hypothetical protein encoded by
FT                   An11g03480 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q7L2"
FT                   /db_xref="InterPro:IPR040632"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L2"
FT                   /protein_id="CAK43488.1"
FT                   /translation="MSVRKREMQVSDVKPTSRPFSSQHSSRRNSFPPISADPFNDPTKD
FT                   RIIKLESPIRSQEKVTLVIFPEKKGRQTNIFCSIYFIPVLNGMLVERAPTLCTLECDIS
FT                   QIRLLLLNQFAMDAIQQFLYVFPEPAPHKGTEPVEELCLGLPRTGIESLSVGLQKLGLD
FT                   TYHGWDLVFEPHGRKLQCCHELVKRNHHAPELLVAYPGAKVILNGRRDVSQIVRLARYA
FT                   LVLRALISIVSIAYTCPVTSPTGMYPNVEPQNFEDWDQGNFQGCGNCAGVEPEHPSVDL
FT                   CIIVFYFSTYLAFVGDIAITTIPYGPGPFGALLLSHPSEFTAESIFELDHPKSCHLCRL
FT                   SPAMPTPEDIDQWLEETFIVHPEAEYNVTSAEKLALSLPPSPFFKLHWVPASRELIFRT
FT                   PHWRTDGAGLMMLQDAFLTLLSSPAEEINFDGSEISRLPPTMNELFCSGFEATEETKKA
FT                   FDGEWQAVFDPSLKPLSWVKHALPGTIPGSTVRLSHKFSKDETKQLITEIKKRGITVTN
FT                   GMASAFMVTAANHATPADGRFILLNPFNVRRYLPAPWNGTAGAGATYHTGRLQSFNLED
FT                   GKDYESACRAVTEFYNRGIKDAFSFMPLLIQAATSLVDTPAEVANSGNGSASVDLSQLG
FT                   LVDDLLQTRYEGPRYTLEIEDWWTGVEFVTKKLQGYTWTRDVNVKAVYIALDSLFNFAM
FT                   QISYMLEAQARPGRGESSHMTKAVSCDPLLRTSLEFKAERYILTLRK"
     MSVRKREMQV SDVKPTSRPF SSQHSSRRNS FPPISADPFN DPTKDRIIKL ESPIRSQEKV        60
     TLVIFPEKKG RQTNIFCSIY FIPVLNGMLV ERAPTLCTLE CDISQIRLLL LNQFAMDAIQ       120
     QFLYVFPEPA PHKGTEPVEE LCLGLPRTGI ESLSVGLQKL GLDTYHGWDL VFEPHGRKLQ       180
     CCHELVKRNH HAPELLVAYP GAKVILNGRR DVSQIVRLAR YALVLRALIS IVSIAYTCPV       240
     TSPTGMYPNV EPQNFEDWDQ GNFQGCGNCA GVEPEHPSVD LCIIVFYFST YLAFVGDIAI       300
     TTIPYGPGPF GALLLSHPSE FTAESIFELD HPKSCHLCRL SPAMPTPEDI DQWLEETFIV       360
     HPEAEYNVTS AEKLALSLPP SPFFKLHWVP ASRELIFRTP HWRTDGAGLM MLQDAFLTLL       420
     SSPAEEINFD GSEISRLPPT MNELFCSGFE ATEETKKAFD GEWQAVFDPS LKPLSWVKHA       480
     LPGTIPGSTV RLSHKFSKDE TKQLITEIKK RGITVTNGMA SAFMVTAANH ATPADGRFIL       540
     LNPFNVRRYL PAPWNGTAGA GATYHTGRLQ SFNLEDGKDY ESACRAVTEF YNRGIKDAFS       600
     FMPLLIQAAT SLVDTPAEVA NSGNGSASVD LSQLGLVDDL LQTRYEGPRY TLEIEDWWTG       660
     VEFVTKKLQG YTWTRDVNVK AVYIALDSLF NFAMQISYML EAQARPGRGE SSHMTKAVSC       720
     DPLLRTSLEF KAERYILTLR K                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page