(data stored in SCRATCH zone)

EMBL: AM269952.PE39

AM269952.PE39        Location/Qualifiers
FT   CDS             complement(95258..96598)
FT                   /locus_tag="An01g01140"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   encoded by An01g12050 - Aspergillus niger"
FT                   /db_xref="GOA:A2Q7L4"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L4"
FT                   /protein_id="CAK43490.1"
FT                   /translation="MTWSQVSAHRWERPGDGLENYFALTASLSAAAYDGRRHYTIFTKL
FT                   QLELDMPATEVECSLKKAWVQLRYEQPQIATVHNGTTKVYEVPDDTALQAWIASTVIIS
FT                   AAANAEDLYASITPIAQATLYYLPASSQLVLRTPHDTIDGIGVIRLLDRLLSILVSPPA
FT                   EKITFGDEPSRLAPTLREILGVAEQPTPEESDRMMALWKPYIDHAPGIGPVSNLGNRPA
FT                   GQSQHARLDVPTRTTEAIIQACKAKNITVTSAVHAAYIETIKKHADPDHPSCHYVNTAQ
FT                   FNLRPYLPKHGSQYTASLGYTLFPVHLESPSSFGPTAQALNQFYRTTFADDPSKLPLVP
FT                   HMTDLLFAVTQNPEYQKGPFPRDAIPSSLGIIENHMRRSYGTNKVIVRDFMLGVDVVMG
FT                   MNMLSISTFRDQLQLVYSFNDAYHEPEHISQYLQEIVTVLTKELLAN"
     MTWSQVSAHR WERPGDGLEN YFALTASLSA AAYDGRRHYT IFTKLQLELD MPATEVECSL        60
     KKAWVQLRYE QPQIATVHNG TTKVYEVPDD TALQAWIAST VIISAAANAE DLYASITPIA       120
     QATLYYLPAS SQLVLRTPHD TIDGIGVIRL LDRLLSILVS PPAEKITFGD EPSRLAPTLR       180
     EILGVAEQPT PEESDRMMAL WKPYIDHAPG IGPVSNLGNR PAGQSQHARL DVPTRTTEAI       240
     IQACKAKNIT VTSAVHAAYI ETIKKHADPD HPSCHYVNTA QFNLRPYLPK HGSQYTASLG       300
     YTLFPVHLES PSSFGPTAQA LNQFYRTTFA DDPSKLPLVP HMTDLLFAVT QNPEYQKGPF       360
     PRDAIPSSLG IIENHMRRSY GTNKVIVRDF MLGVDVVMGM NMLSISTFRD QLQLVYSFND       420
     AYHEPEHISQ YLQEIVTVLT KELLAN                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page