(data stored in SCRATCH zone)

EMBL: AM269952.PE40

AM269952.PE40        Location/Qualifiers
FT   CDS             join(96859..97069,97091..97374,97437..98342,98740..98877)
FT                   /locus_tag="An01g01150"
FT                   /note="Function: M. grisea Pth11p can activate appressorium
FT                   differentiation in response to inductive surface cues and
FT                   repress differentiation on poorly inductive surfaces using
FT                   multiple signaling pathways to mediate differentiation."
FT                   /note="Remark: the adjacent genomic region contains another
FT                   predicted A. niger protein with similarity to M. grisea
FT                   PTH11."
FT                   /note="Similarity: similarity is from the N-terminal region
FT                   of the predicted A. niger protein to the N-terminal region
FT                   of M. grisea PTH11, which is 100 aa longer."
FT                   /note="Title: similarity to surface recognition protein
FT                   PTH11 - Magnaporthe grisea"
FT                   /note="localisation:plasma membrane"
FT                   /note="See PMID 10521529"
FT                   /db_xref="GOA:A2Q7L5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L5"
FT                   /inference="similar to AA sequence:UniProtKB:AF119672.1"
FT                   /protein_id="CAK43491.1"
FT                   /translation="MPWGFSTQPPQRLFPLLPLFALADCCVISFGLSYCRQHFGTVTRP
FT                   GSPEADRETDGGNKAQLPPTSFTPARQVLHRILFIGSQQPSLLSFVLLVTKFTLFALAC
FT                   FTVLFMALDIPKDTPDCGEGILITSIFLIILIIIFTVLRVVSKFVTHQDWWWDDFFALL
FT                   ALPFELIVLSLVVAWRQIGLGYHMEVVAAINPEYLLTGARYLYVAIFFFDGSVCLPKIS
FT                   ALFFYARIFRTNNRTFRIHLWIVGGLTSTWLLAAWISTGLECQPIAKAWNTVLPGTCIA
FT                   QFQWYLSTAALSCMIDFYILFLPIPMIWGLQASLKRRVYLLIAFMMAYSVVVLSLGRLV
FT                   AVIQFIPIMNQDLTWHFVKYGYWSILEGSISIISISVPSCLALAKALRNTSDPKIYLDS
FT                   NKASTNSPSYISSHFGEQKDTVSWQNGHSGCGSVDKLVSDIHVSPGEYGHHRNLDIPLG
FT                   AVRIETDIEPSAGLQLSGGRFDRNDMGISQYLLNLLTTCSQILPGYYEEVSAGR"
     MPWGFSTQPP QRLFPLLPLF ALADCCVISF GLSYCRQHFG TVTRPGSPEA DRETDGGNKA        60
     QLPPTSFTPA RQVLHRILFI GSQQPSLLSF VLLVTKFTLF ALACFTVLFM ALDIPKDTPD       120
     CGEGILITSI FLIILIIIFT VLRVVSKFVT HQDWWWDDFF ALLALPFELI VLSLVVAWRQ       180
     IGLGYHMEVV AAINPEYLLT GARYLYVAIF FFDGSVCLPK ISALFFYARI FRTNNRTFRI       240
     HLWIVGGLTS TWLLAAWIST GLECQPIAKA WNTVLPGTCI AQFQWYLSTA ALSCMIDFYI       300
     LFLPIPMIWG LQASLKRRVY LLIAFMMAYS VVVLSLGRLV AVIQFIPIMN QDLTWHFVKY       360
     GYWSILEGSI SIISISVPSC LALAKALRNT SDPKIYLDSN KASTNSPSYI SSHFGEQKDT       420
     VSWQNGHSGC GSVDKLVSDI HVSPGEYGHH RNLDIPLGAV RIETDIEPSA GLQLSGGRFD       480
     RNDMGISQYL LNLLTTCSQI LPGYYEEVSA GR                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page