(data stored in SCRATCH zone)

EMBL: AM269952.PE41

AM269952.PE41        Location/Qualifiers
FT   CDS             99575..100765
FT                   /locus_tag="An01g01160"
FT                   /EC_number="2.3.1.-"
FT                   /note="Function: S. viridochromogenes pat is involved in
FT                   the metabolism of the herbicide glufosinate and can confer
FT                   resistance against glufosinate."
FT                   /note="Similarity: similarity is from the C-terminal region
FT                   of the predicted A. niger protein to S. viridochromogenes
FT                   pat, which is 100 aa shorter."
FT                   /note="Title: similarity to phosphinothricin
FT                   N-acetyltransferase pat - Streptomyces viridochromogenes"
FT                   /note="See PMID 3240868"
FT                   /db_xref="GOA:A2Q7L6"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L6"
FT                   /inference="profile:COGS:COG0657"
FT                   /protein_id="CAK43492.1"
FT                   /translation="MRSPAPLSQTSTSAPSAGSILMPSKAFTFFYTAYTLVTAPVWLAA
FT                   AAIYNIPKFLRPNAAWSWKTAITSSQSTMTMIYLTTIQRAWPKSLEAGPLGNQFIVLKP
FT                   QKTITTKTKEGQGSTQFEVYKGITCSVPGVEPLPVGAVWFPEAPAEPPRRLIIHFYGSA
FT                   YVMFGSRPGETGEVGINELSKMSGWPALAIQYRLSRDKKTTFPAALQDGITAYVYALEV
FT                   LKIPASQIVFAGDSAGGNLVVALLRYINEENPALPLPRCAILSSPWVDLSTKSIENVPR
FT                   NRNYNADYVTQDFLDWGRKAYTPEGWDSNNSWITFLGNETQLGTPVFVNAGTSEVLYDD
FT                   IMKFAENLRKKGNEVEVLETPNSCHVPYRLGKDWDLEEEQAICLATMTKFLEKTGA"
     MRSPAPLSQT STSAPSAGSI LMPSKAFTFF YTAYTLVTAP VWLAAAAIYN IPKFLRPNAA        60
     WSWKTAITSS QSTMTMIYLT TIQRAWPKSL EAGPLGNQFI VLKPQKTITT KTKEGQGSTQ       120
     FEVYKGITCS VPGVEPLPVG AVWFPEAPAE PPRRLIIHFY GSAYVMFGSR PGETGEVGIN       180
     ELSKMSGWPA LAIQYRLSRD KKTTFPAALQ DGITAYVYAL EVLKIPASQI VFAGDSAGGN       240
     LVVALLRYIN EENPALPLPR CAILSSPWVD LSTKSIENVP RNRNYNADYV TQDFLDWGRK       300
     AYTPEGWDSN NSWITFLGNE TQLGTPVFVN AGTSEVLYDD IMKFAENLRK KGNEVEVLET       360
     PNSCHVPYRL GKDWDLEEEQ AICLATMTKF LEKTGA                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page