(data stored in SCRATCH zone)

EMBL: AM269952.PE42

AM269952.PE42        Location/Qualifiers
FT   CDS             102437..103654
FT                   /locus_tag="An01g01170"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   BAC47708.1 - Bradyrhizobium japonicum"
FT                   /db_xref="GOA:A2Q7L7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L7"
FT                   /protein_id="CAK43493.1"
FT                   /translation="MKTFTSALIGAAALAQNVNSSLLSGPAGLEFPNVTGLMNHTVHVS
FT                   NGGSAHCISGIVKVNATTDKNLKFAYNLPSNQSQVTRTLVSLWSSGGDGYVKSLTSGTQ
FT                   RITGSYDIEATYCLPAGENSKTTKVQLLTHGIGVDRHYWDFASGYSYVDTAAAAGYATF
FT                   LYNRLGVGASSKEDPLNAVQSPLELEILEALASKLRQGTLGDRAFTTVVGVGHSFGSIL
FT                   TQGVTAAYPKTLDAAVLTGFTLNSNGLPGFGLGLNAAIASETQPYRFSGLSTGYLVAGT
FT                   PVSNQIAFFYDPGFDPEILSLADATKGSFTLGELFTLTHVINATSEFQGPVAVVAGNED
FT                   LPFCNGNCSSPSNILAGLVPALYPEVSEENTATYVAPAVGHALNLHYAAPGAFNFIQDF
FT                   LKKHNV"
     MKTFTSALIG AAALAQNVNS SLLSGPAGLE FPNVTGLMNH TVHVSNGGSA HCISGIVKVN        60
     ATTDKNLKFA YNLPSNQSQV TRTLVSLWSS GGDGYVKSLT SGTQRITGSY DIEATYCLPA       120
     GENSKTTKVQ LLTHGIGVDR HYWDFASGYS YVDTAAAAGY ATFLYNRLGV GASSKEDPLN       180
     AVQSPLELEI LEALASKLRQ GTLGDRAFTT VVGVGHSFGS ILTQGVTAAY PKTLDAAVLT       240
     GFTLNSNGLP GFGLGLNAAI ASETQPYRFS GLSTGYLVAG TPVSNQIAFF YDPGFDPEIL       300
     SLADATKGSF TLGELFTLTH VINATSEFQG PVAVVAGNED LPFCNGNCSS PSNILAGLVP       360
     ALYPEVSEEN TATYVAPAVG HALNLHYAAP GAFNFIQDFL KKHNV                       405
//

If you have problems or comments...

PBIL Back to PBIL home page