(data stored in SCRATCH zone)

EMBL: AM269952.PE43

AM269952.PE43        Location/Qualifiers
FT   CDS             complement(join(105008..105231,105263..105640,
FT                   105700..106376,106503..106675))
FT                   /locus_tag="An01g01180"
FT                   /note="Similarity: the C-terminal region of the predicted
FT                   A. niger protein contains a chromate transporter motif."
FT                   /note="Title: strong similarity to hypothetical conserved
FT                   protein CAD21291.1 - Neurospora crassa"
FT                   /db_xref="GOA:A2Q7L8"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L8"
FT                   /inference="profile:COGS:COG2059"
FT                   /inference="similar to AA sequence:UniProtKB:NCG15G9.4"
FT                   /protein_id="CAK43494.1"
FT                   /translation="MPAQPTRHAQKSPFLNAWARSCDIPGIWDLRLLGVRRFISRFFTR
FT                   GLSNRKSGLMSRRFTPVSSRPYWHLSYGGMSTALIASLAIRNDGLISFTSLPGAVGMYA
FT                   LSLGVQRIDETLPAAVYALLSGLNASTVGIVALAAVQLAEKAIRDKIARILVIFGACAG
FT                   LCYSALWYFPVLMVAGGVTTALWDGWIYQQILRARMAWKNRNRQPEPEGDEPGSAGRES
FT                   SSMQSPEQGARIEMLRMRKSGAEASPPNSTNIQAPEGGEAAPAWEHIIRIRVGAAILIF
FT                   FFASFIAILVTRAKLSAPPLSLELFANMYLAGTVIFGGGPVVIPLLRSYVVDPGWVSSR
FT                   DFLIGLAIIQAFPGPNFNFAVFLGALAVRTTSYPTVFGAFLCGLGIFFPGITLAVAIQS
FT                   FWRVLRKQVYSVGLVFTAVYRLWEIGYLTPQDRDGQSLAKEPWWVVIAAVTYAQSAWFK
FT                   VPPAVAIVLGAVLGLCWYEVVSPAW"
     MPAQPTRHAQ KSPFLNAWAR SCDIPGIWDL RLLGVRRFIS RFFTRGLSNR KSGLMSRRFT        60
     PVSSRPYWHL SYGGMSTALI ASLAIRNDGL ISFTSLPGAV GMYALSLGVQ RIDETLPAAV       120
     YALLSGLNAS TVGIVALAAV QLAEKAIRDK IARILVIFGA CAGLCYSALW YFPVLMVAGG       180
     VTTALWDGWI YQQILRARMA WKNRNRQPEP EGDEPGSAGR ESSSMQSPEQ GARIEMLRMR       240
     KSGAEASPPN STNIQAPEGG EAAPAWEHII RIRVGAAILI FFFASFIAIL VTRAKLSAPP       300
     LSLELFANMY LAGTVIFGGG PVVIPLLRSY VVDPGWVSSR DFLIGLAIIQ AFPGPNFNFA       360
     VFLGALAVRT TSYPTVFGAF LCGLGIFFPG ITLAVAIQSF WRVLRKQVYS VGLVFTAVYR       420
     LWEIGYLTPQ DRDGQSLAKE PWWVVIAAVT YAQSAWFKVP PAVAIVLGAV LGLCWYEVVS       480
     PAW                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page