(data stored in SCRATCH zone)

EMBL: AM269952.PE44

AM269952.PE44        Location/Qualifiers
FT   CDS             107534..108166
FT                   /locus_tag="An01g01190"
FT                   /note="Similarity: the predicted A. niger protein contains
FT                   a phosphoglycerate mutase motif."
FT                   /note="Title: similarity to hypothetical phosphoglycerate
FT                   mutase SPAC5H10.03 - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q7L9"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L9"
FT                   /inference="profile:COGS:COG0588"
FT                   /inference="similar to AA sequence:PIR:S55481"
FT                   /protein_id="CAK43495.1"
FT                   /translation="MALKVHLVRHAESVHNVTHDFSQLDPELTPLGLQQATGLGQLFPY
FT                   APQVGVIITSPLKRAIQTTLTAFSHILDKRYFDPDSGDGVENGAVLFLEPDLQERSALP
FT                   CDTGSPTRVLEAAFPRLGFQDLAEGWQVKEDFYSPADEAVEERAQRMRSRIAAVCEDLQ
FT                   HQGRTDVVVVTHGVFMKFLSGDPDIDLPKAGWRSYAVGTGTVFSKCS"
     MALKVHLVRH AESVHNVTHD FSQLDPELTP LGLQQATGLG QLFPYAPQVG VIITSPLKRA        60
     IQTTLTAFSH ILDKRYFDPD SGDGVENGAV LFLEPDLQER SALPCDTGSP TRVLEAAFPR       120
     LGFQDLAEGW QVKEDFYSPA DEAVEERAQR MRSRIAAVCE DLQHQGRTDV VVVTHGVFMK       180
     FLSGDPDIDL PKAGWRSYAV GTGTVFSKCS                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page