(data stored in SCRATCH zone)

EMBL: AM269952.PE45

AM269952.PE45        Location/Qualifiers
FT   CDS             complement(join(108631..110202,110261..110626))
FT                   /locus_tag="An01g01210"
FT                   /EC_number="3.4.19.1"
FT                   /note="Function: R. norvegicus acyl-peptide hydrolase is a
FT                   serine protease which catalyzes the removal of an N
FT                   alpha-acetylated amino acid residue from an N
FT                   alpha-acetylated peptide."
FT                   /note="Similarity: the predicted A. niger protein shows
FT                   strong similarity to several putative mikrobial
FT                   acyl-peptide hydrolases."
FT                   /note="Title: similarity to acylaminoacyl-peptidase -Rattus
FT                   norvegicus"
FT                   /note="See PMID 2722805"
FT                   /db_xref="GOA:A2Q7M0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M0"
FT                   /inference="profile:COGS:COG1506"
FT                   /protein_id="CAK43496.1"
FT                   /translation="MVTDPNDKAQLNLQALADLQVPRDLSISPDGSRIAYALQPLSKKG
FT                   DHATSSIWIATVDKEYSSRQFTSGLFNDEQPQWSPAGTLIAFKSDRHRPGKSSAIYVLP
FT                   VDGGEAYPVTPVDCEKPIKTEEQVSKEKVKMIQLFGGKDLEYSRLRIAHVATGQIRTIV
FT                   AGHRHVHDFTWSPDSTQICFVAHKGPDINSAGFYGAEILITSISGSEEKLVAQFPGPIS
FT                   QIAWGNCGVFFIAGHVPTHCLTSLSLYELNIEYGSYTERKDGDEAHCCITLRKNQSCLS
FT                   YRVQRYLNDEFFSISDDGTRTKAYSEKCEMSSFDVLKTTDSSDIIAITRGDGSNPEEVF
FT                   SISKSTGPVKLSAHNSSIAALEISKSWSISNYARDGYYLDGMMYVPSAYKFEDGPLPTI
FT                   LIPHGGPYWRVTTGFAVCHCLEVPVLVSMGYAVLCPNYRGGSGRGEAHAAYARGGVGTV
FT                   DYTDCIDLLQYSIARGSVDPARVAIAGWSQGGFLSYFAVTREEFQFRGAICGAGISEWN
FT                   SMAMMSDAYWMQGEVVGGAPWDVDTNLKPGEEDSITSPEKRWIGDTNGRRGSALWHMRN
FT                   VKTPILILHGEDDERVPLEQAIAFYRACVHNNVPVEMVTYPREGHFIVERRHLIDMWER
FT                   MRTFCYRNLQ"
     MVTDPNDKAQ LNLQALADLQ VPRDLSISPD GSRIAYALQP LSKKGDHATS SIWIATVDKE        60
     YSSRQFTSGL FNDEQPQWSP AGTLIAFKSD RHRPGKSSAI YVLPVDGGEA YPVTPVDCEK       120
     PIKTEEQVSK EKVKMIQLFG GKDLEYSRLR IAHVATGQIR TIVAGHRHVH DFTWSPDSTQ       180
     ICFVAHKGPD INSAGFYGAE ILITSISGSE EKLVAQFPGP ISQIAWGNCG VFFIAGHVPT       240
     HCLTSLSLYE LNIEYGSYTE RKDGDEAHCC ITLRKNQSCL SYRVQRYLND EFFSISDDGT       300
     RTKAYSEKCE MSSFDVLKTT DSSDIIAITR GDGSNPEEVF SISKSTGPVK LSAHNSSIAA       360
     LEISKSWSIS NYARDGYYLD GMMYVPSAYK FEDGPLPTIL IPHGGPYWRV TTGFAVCHCL       420
     EVPVLVSMGY AVLCPNYRGG SGRGEAHAAY ARGGVGTVDY TDCIDLLQYS IARGSVDPAR       480
     VAIAGWSQGG FLSYFAVTRE EFQFRGAICG AGISEWNSMA MMSDAYWMQG EVVGGAPWDV       540
     DTNLKPGEED SITSPEKRWI GDTNGRRGSA LWHMRNVKTP ILILHGEDDE RVPLEQAIAF       600
     YRACVHNNVP VEMVTYPREG HFIVERRHLI DMWERMRTFC YRNLQ                       645
//

If you have problems or comments...

PBIL Back to PBIL home page