(data stored in SCRATCH zone)

EMBL: AM269952.PE47

AM269952.PE47        Location/Qualifiers
FT   CDS             join(114311..114643,114697..115041)
FT                   /locus_tag="An01g01230"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPAC869.06c - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q7M2"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M2"
FT                   /inference="profile:COGS:COG2846"
FT                   /inference="profile:COGS:COG5592"
FT                   /inference="profile:PFAM:PF03794"
FT                   /inference="similar to AA sequence:PIR:T39117"
FT                   /protein_id="CAK43498.1"
FT                   /translation="MTSRYILNSSRPILRPLLSIPKQHRSISQSPIIMAPRISEAIKTD
FT                   HREIEDYYNKILNSATEKEKIEWQNQFTWELARHSIAEELVVYPQFEKSIPDGRAMADK
FT                   DRKEHQSVKEQLKKFQNMKPADPEFESTIRALMKDLSEHIKEEESQDLPKLEDAVSAEE
FT                   SEKLSKSFGRTKMFVPSRSHPSAPDKPPFETAIGLMTAPIDHLADLFRKWPHTSGMPNP
FT                   STK"
     MTSRYILNSS RPILRPLLSI PKQHRSISQS PIIMAPRISE AIKTDHREIE DYYNKILNSA        60
     TEKEKIEWQN QFTWELARHS IAEELVVYPQ FEKSIPDGRA MADKDRKEHQ SVKEQLKKFQ       120
     NMKPADPEFE STIRALMKDL SEHIKEEESQ DLPKLEDAVS AEESEKLSKS FGRTKMFVPS       180
     RSHPSAPDKP PFETAIGLMT APIDHLADLF RKWPHTSGMP NPSTK                       225
//

If you have problems or comments...

PBIL Back to PBIL home page