(data stored in SCRATCH zone)

EMBL: AM269952.PE48

AM269952.PE48        Location/Qualifiers
FT   CDS             complement(115304..>115861)
FT                   /locus_tag="An01g01240"
FT                   /note="Function: C. carbonum TOXA likely encodes an
FT                   HC-toxin efflux pump which contributes to self-protection
FT                   against HC-toxin and/or the secretion of HC-toxin into the
FT                   extracellular milieu."
FT                   /note="Remark: ORF 5'truncated due to end of contig."
FT                   /note="Remark: the function of C. carbonum TOXA is
FT                   indicated by its sequence similarity to the major
FT                   facilitator superfamily and the impossibility to mutate
FT                   TOXA in HC-toxin producing strains."
FT                   /note="Similarity: C. carbonum TOXA is a member of the
FT                   major facilitator superfamily."
FT                   /note="Title: similarity to HC-toxin efflux pump TOXA
FT                   -Cochliobolus carbonum [truncated ORF]"
FT                   /note="localisation:plasma membrane"
FT                   /note="See PMID 8704997"
FT                   /db_xref="GOA:A2Q7M3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M3"
FT                   /inference="profile:COGS:COG0477"
FT                   /protein_id="CAK43499.1"
FT                   /translation="ISGMLLTTLGYGLFIDLPSTKSWPRIILFQIVAGLGIGPNFQATL
FT                   IALQANTTPAELSRGTGTFSFVRQLAAAISVVVGSVLYARAVSGQRGALAAVLGETVAQ
FT                   EIVEASTAAAAIVETLPVGEDRTVVFHALTAALRWVWVFYTAVAGVGFLLSLCLRDLRL
FT                   GDAHRMAPGQESEELEMERGTT"
     ISGMLLTTLG YGLFIDLPST KSWPRIILFQ IVAGLGIGPN FQATLIALQA NTTPAELSRG        60
     TGTFSFVRQL AAAISVVVGS VLYARAVSGQ RGALAAVLGE TVAQEIVEAS TAAAAIVETL       120
     PVGEDRTVVF HALTAALRWV WVFYTAVAGV GFLLSLCLRD LRLGDAHRMA PGQESEELEM       180
     ERGTT                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page