(data stored in SCRATCH zone)

EMBL: AM269952.PE7

AM269952.PE7         Location/Qualifiers
FT   CDS             complement(join(10928..11010,11079..11919))
FT                   /locus_tag="An01g00800"
FT                   /note="Title: similarity to hypothetical protein AAO51454.1
FT                   - Dictyostelium discoideum"
FT                   /db_xref="GOA:A2Q7I2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I2"
FT                   /protein_id="CAK43458.1"
FT                   /translation="MSSDQTASYLPTPNNVQPTKGPRYKRKYLVSILLGTISLVAIIVA
FT                   VVCLSVLLPKRLKHDNNHDGGNHNTGVSTTQGNDTHSLDPDGSTYNGGGVQNGTGTHTT
FT                   GATPTGDVPHQPSATSNGEDSQRPNGVVNVTDTQPVQGGSQSQDGECHVVSKVSYTFYG
FT                   YPDNDPPGSDISEDCGRGMAAGGIGTHENPLTFATAPGEFDRCEVVYSPYLQKYLINED
FT                   YCEQCTKDWKSHIWHVDVWLGGNSTTYGTEQLKCENSLTSAEESQVVIKNPSSNLPVDL
FT                   TSFYLGGNSVCSLDHIYPEYDTNDYC"
     MSSDQTASYL PTPNNVQPTK GPRYKRKYLV SILLGTISLV AIIVAVVCLS VLLPKRLKHD        60
     NNHDGGNHNT GVSTTQGNDT HSLDPDGSTY NGGGVQNGTG THTTGATPTG DVPHQPSATS       120
     NGEDSQRPNG VVNVTDTQPV QGGSQSQDGE CHVVSKVSYT FYGYPDNDPP GSDISEDCGR       180
     GMAAGGIGTH ENPLTFATAP GEFDRCEVVY SPYLQKYLIN EDYCEQCTKD WKSHIWHVDV       240
     WLGGNSTTYG TEQLKCENSL TSAEESQVVI KNPSSNLPVD LTSFYLGGNS VCSLDHIYPE       300
     YDTNDYC                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page