(data stored in SCRATCH zone)

EMBL: AM269952.PE8

AM269952.PE8         Location/Qualifiers
FT   CDS             complement(join(12834..12867,12920..13269))
FT                   /locus_tag="An01g00810"
FT                   /note="Title: weak similarity to androgen receptor A hARa
FT                   -Homo sapiens"
FT                   /db_xref="GOA:A2Q7I3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I3"
FT                   /protein_id="CAK43459.1"
FT                   /translation="MADDPDVSQWQFSTTWLYFPCTEEYQNRAEQFQRAIENIDSLTYA
FT                   IYHYNPAIPPTMRGVLLAVYHPLDYGTASILAIARGDLVSYRNAAAGQPGGMGPSQSTI
FT                   YLSLNEDDDMDTSEDAMMSTDIQ"
     MADDPDVSQW QFSTTWLYFP CTEEYQNRAE QFQRAIENID SLTYAIYHYN PAIPPTMRGV        60
     LLAVYHPLDY GTASILAIAR GDLVSYRNAA AGQPGGMGPS QSTIYLSLNE DDDMDTSEDA       120
     MMSTDIQ                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page