(data stored in SCRATCH zone)

EMBL: AM269952.PE9

AM269952.PE9         Location/Qualifiers
FT   CDS             join(14764..14840,14902..15344,15407..16044,16100..16534)
FT                   /locus_tag="An01g00820"
FT                   /note="Function: The QUTD gene encodes an essential
FT                   component of a permease required for transport of quinate
FT                   ion into mycelium."
FT                   /note="Localization: The QUTD gene has been located within
FT                   the cloned QUT gene cluster of A. nidulans."
FT                   /note="Similarity: The QutD gene shows strong homology with
FT                   the N. crassa QA-Y gene."
FT                   /note="Title: strong similarity to quinate transport
FT                   protein qutD - Aspergillus nidulans"
FT                   /note="See PMID 2835177"
FT                   /note="See PMID 2976880"
FT                   /db_xref="GOA:A2Q7I4"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I4"
FT                   /inference="profile:COGS:COG0477"
FT                   /inference="profile:PFAM:PF00083"
FT                   /inference="similar to AA sequence:PIR:S08498"
FT                   /protein_id="CAK43460.1"
FT                   /translation="MALWKFPKLNSTLGTLRAYHLAAIIFVSSFLAGYDSGIAGGILSY
FT                   KTFEDDFRYTSAHESKVSSLTVGLEQLGSFVASLFAYYLTDKFGRKWVIIGSTAVFCIG
FT                   VIIQVINTHSLGAWYAGRIIAGIGMGGQSVVVPMYSAEMTPKEIRGRCGSFYQWLYTWG
FT                   ILAAYWIDYVPSASISKTSREWQIPVGLQLVSGGIMVIGACTLPESVRWLLSQNRADEA
FT                   WKSLTWIRGDEGEKTIEEFKETQLGLKAEKAAKENFSLRELWEPANRLRFCVGPMLFVF
FT                   QNATGSSALAVFAPEYFKLLVGSGGNRDLLLTGLFGAVKFIACTFFILFLAERFGRRIL
FT                   LTGGSVFMAICMLITALIVKCIPTESNTSVTSAGRATVAMLYLDIMVYNCSWGPVPWAY
FT                   VPEIFPTRIRALGLACSMLAHWATSFCFSFASPYMIDNIGANTFLLFMAFDIAAALFCF
FT                   VFVRETRGQNLEVAAGTEWDVVEKSADDLAASEKGEVDIDKPSEIGVAPAAGKQLEVVA
FT                   VHDTYGSNFKRRS"
     MALWKFPKLN STLGTLRAYH LAAIIFVSSF LAGYDSGIAG GILSYKTFED DFRYTSAHES        60
     KVSSLTVGLE QLGSFVASLF AYYLTDKFGR KWVIIGSTAV FCIGVIIQVI NTHSLGAWYA       120
     GRIIAGIGMG GQSVVVPMYS AEMTPKEIRG RCGSFYQWLY TWGILAAYWI DYVPSASISK       180
     TSREWQIPVG LQLVSGGIMV IGACTLPESV RWLLSQNRAD EAWKSLTWIR GDEGEKTIEE       240
     FKETQLGLKA EKAAKENFSL RELWEPANRL RFCVGPMLFV FQNATGSSAL AVFAPEYFKL       300
     LVGSGGNRDL LLTGLFGAVK FIACTFFILF LAERFGRRIL LTGGSVFMAI CMLITALIVK       360
     CIPTESNTSV TSAGRATVAM LYLDIMVYNC SWGPVPWAYV PEIFPTRIRA LGLACSMLAH       420
     WATSFCFSFA SPYMIDNIGA NTFLLFMAFD IAAALFCFVF VRETRGQNLE VAAGTEWDVV       480
     EKSADDLAAS EKGEVDIDKP SEIGVAPAAG KQLEVVAVHD TYGSNFKRRS                  530
//

If you have problems or comments...

PBIL Back to PBIL home page