(data stored in SCRATCH zone)

EMBL: AM269952.XYNB

AM269952.XYNB        Location/Qualifiers
FT   CDS             complement(join(9153..9552,9621..9898))
FT                   /gene="xynB"
FT                   /locus_tag="An01g00780"
FT                   /product="endo-1,4-xylanase xynB-Aspergillus niger"
FT                   /note="Catalytic activity: Endohydrolysis of
FT                   1,4-beta-d-xylosidic linkages in xylans."
FT                   /note="Gene-ID: xynB"
FT                   /note="Pathway: Xylan degradation."
FT                   /note="Similarity: Belongs to cellulase family g (family 11
FT                   of glycosyl hydrolases)."
FT                   /db_xref="GOA:A2Q7I0"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="InterPro:IPR033119"
FT                   /db_xref="InterPro:IPR033123"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q7I0"
FT                   /inference="profile:PFAM:PF00457"
FT                   /inference="similar to AA sequence:SWISSPROT:XYN2.ASPNG"
FT                   /protein_id="CAK43456.1"
FT                   /translation="MLTKNLLLCFAAAKAALAVPHDSVAQRSDALHMLSERSTPSSTGE
FT                   NNGFYYSFWTDGGGDVTYTNGDAGAYTVEWSNVGNFVGGKGWNPGSAQDITYSGTFTPS
FT                   GNGYLSVYGWTTDPLIEYYIVESYGDYNPGSGGTYKGTVTSDGSVYDIYTATRTNAASI
FT                   QGTATFTQYWSVRQNKRVGGTVTTSNHFNAWAKLGMNLGTHNYQIVATEGYQSSGSSSI
FT                   TVQ"
     MLTKNLLLCF AAAKAALAVP HDSVAQRSDA LHMLSERSTP SSTGENNGFY YSFWTDGGGD        60
     VTYTNGDAGA YTVEWSNVGN FVGGKGWNPG SAQDITYSGT FTPSGNGYLS VYGWTTDPLI       120
     EYYIVESYGD YNPGSGGTYK GTVTSDGSVY DIYTATRTNA ASIQGTATFT QYWSVRQNKR       180
     VGGTVTTSNH FNAWAKLGMN LGTHNYQIVA TEGYQSSGSS SITVQ                       225
//

If you have problems or comments...

PBIL Back to PBIL home page