(data stored in ACNUC7421 zone)

EMBL: AM269962.PE1

AM269962.PE1         Location/Qualifiers
FT   CDS             complement(join(<1..437,505..1048,1112..1257,1328..1628))
FT                   /locus_tag="An01g04210"
FT                   /note="Function: SutB of P. chrysogenum is the major
FT                   sulfate permease involved in sulfate uptake by P.
FT                   chrysogenum."
FT                   /note="Function: in industrial fermentations, P.
FT                   chrysogenum uses sulfate as the source of sulfur for the
FT                   biosynthesis of penicillin."
FT                   /note="Phenotype: disruption of P. chrysogenum sutB
FT                   resulted in a loss of sulfate uptake ability."
FT                   /note="Remark: the C-terminal half of the homolog to SutB
FT                   of P. chrysogenum is located on An01g04200."
FT                   /note="Remark: the ORF is C-terminally truncated due to
FT                   contig border."
FT                   /note="Title: strong similarity to sulfate permease SutB
FT                   -Penicillium chrysogenum [truncated ORF]"
FT                   /db_xref="GOA:A2Q8G0"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G0"
FT                   /inference="profile:COGS:COG0659"
FT                   /inference="profile:PFAM:PF00916"
FT                   /inference="similar to AA sequence:UniProtKB:AF163974.1"
FT                   /protein_id="CAK36957.1"
FT                   /translation="MSQDLMTKTGHGLAKVLGIKLPYRDPLGAHSDPVTRGESTFSYGT
FT                   VDTYSYLEPEPTTAEWLKEICPTWHDVLMYFYRLFPFLSWITKYNLQWFFGDLVAGVTV
FT                   GAVVVPQGMAYAKLAELPVQYGLYSSFMGVLVYWFFATSKDITIGPVAVMSTLVGTIVL
FT                   QAQKEIPDVPGHIVASCLAIICGAIVCALGLLRLGFIVDFIPLPAISAFMTGSALNIAA
FT                   GQVKKLLGESADFSTRGSTYMIIINSLKYLPTAGIDAALGVTALAMLYIIRSGCNYGAR
FT                   KYPRHAKVWFFASTLRTVFVILFYTMISAAVNLHRKDNPMFDLLGSVPRGFQNAAVPVV
FT                   NARIIKVFASQLPACVIVLLIEHIAISKSFGRVNNYTIEPSQELVGIGVTNLLGPFLGA
FT                   YPATGSFSRTAIKSKAGVRTPLAGCITAIVVLLAIYALTAVFFYIPQAALSGVIIHAVG
FT                   DLITPPNTVYQLLARTRP"
     MSQDLMTKTG HGLAKVLGIK LPYRDPLGAH SDPVTRGEST FSYGTVDTYS YLEPEPTTAE        60
     WLKEICPTWH DVLMYFYRLF PFLSWITKYN LQWFFGDLVA GVTVGAVVVP QGMAYAKLAE       120
     LPVQYGLYSS FMGVLVYWFF ATSKDITIGP VAVMSTLVGT IVLQAQKEIP DVPGHIVASC       180
     LAIICGAIVC ALGLLRLGFI VDFIPLPAIS AFMTGSALNI AAGQVKKLLG ESADFSTRGS       240
     TYMIIINSLK YLPTAGIDAA LGVTALAMLY IIRSGCNYGA RKYPRHAKVW FFASTLRTVF       300
     VILFYTMISA AVNLHRKDNP MFDLLGSVPR GFQNAAVPVV NARIIKVFAS QLPACVIVLL       360
     IEHIAISKSF GRVNNYTIEP SQELVGIGVT NLLGPFLGAY PATGSFSRTA IKSKAGVRTP       420
     LAGCITAIVV LLAIYALTAV FFYIPQAALS GVIIHAVGDL ITPPNTVYQL LARTRP           476
//

If you have problems or comments...

PBIL Back to PBIL home page