(data stored in ACNUC7421 zone)

EMBL: AM269962.PE10

AM269962.PE10        Location/Qualifiers
FT   CDS             complement(join(20206..20253,20308..21813))
FT                   /locus_tag="An01g04310"
FT                   /note="Function: the S. pombe homolog Mex67p participates
FT                   at various common steps with Rae1p export complexes in
FT                   promoting the nuclear cytoplasmic export of mRNA."
FT                   /note="Similarity: S. pombe Mex67p has similarity to the
FT                   human mRNA export factor Tap."
FT                   /note="Title: strong similarity to mRNA export factor
FT                   mex67p - Schizosaccharomyces pombe"
FT                   /note="nucleus"
FT                   /db_xref="GOA:A2Q8G9"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR005637"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR030217"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G9"
FT                   /inference="profile:PFAM:PF03943"
FT                   /inference="similar to AA sequence:PIR:T43683"
FT                   /protein_id="CAK36966.1"
FT                   /translation="MLQLNGFSFAGAPLTTEKYDPSTGGLLDQPMLSAMAQNGGTSSAA
FT                   ETKAKMTTILGKRYTQQTKLLDLSKLGTDPDLLAMGIFGSTSTESKFFPALMKVWELNF
FT                   DNATARREAVESVSLAHNQLANITAVTALASTIPDLKNLDLSNNEFKDAQSLIGWRWKF
FT                   RNLEFLDLSNTPFSADPTFKDTMLKWYPKLRFLNNVEVRTAEEIAAQKKTPIPVQPPHF
FT                   QDDSQIAENFVRAFFAGYDNDRSGILNSVYDNHTTFTLNVNTSAPRAQQTETAPWDAYI
FT                   KKSRNLLKISHLPARMSRVYTGAEKIRELWTSLPATRHPDIATRPEEWLIECYPIPGLP
FT                   DISGQSSTGVGGLLIMVHGKFDEINGAKVETRSFDRTFIIGPGGGMGGIRVVSDILCLR
FT                   AYGGHEAWIPEVPPAVPQAAPPAAPAPAPAAPAAPAALPVAIPGAPEGYGMPAPGKADA
FT                   QVQQEQLVLQMSSNTRMTLQYSEMALSGNGWNMEAALKNFEELKAQGTLPPEAFLPAAV
FT                   "
     MLQLNGFSFA GAPLTTEKYD PSTGGLLDQP MLSAMAQNGG TSSAAETKAK MTTILGKRYT        60
     QQTKLLDLSK LGTDPDLLAM GIFGSTSTES KFFPALMKVW ELNFDNATAR REAVESVSLA       120
     HNQLANITAV TALASTIPDL KNLDLSNNEF KDAQSLIGWR WKFRNLEFLD LSNTPFSADP       180
     TFKDTMLKWY PKLRFLNNVE VRTAEEIAAQ KKTPIPVQPP HFQDDSQIAE NFVRAFFAGY       240
     DNDRSGILNS VYDNHTTFTL NVNTSAPRAQ QTETAPWDAY IKKSRNLLKI SHLPARMSRV       300
     YTGAEKIREL WTSLPATRHP DIATRPEEWL IECYPIPGLP DISGQSSTGV GGLLIMVHGK       360
     FDEINGAKVE TRSFDRTFII GPGGGMGGIR VVSDILCLRA YGGHEAWIPE VPPAVPQAAP       420
     PAAPAPAPAA PAAPAALPVA IPGAPEGYGM PAPGKADAQV QQEQLVLQMS SNTRMTLQYS       480
     EMALSGNGWN MEAALKNFEE LKAQGTLPPE AFLPAAV                                517
//

If you have problems or comments...

PBIL Back to PBIL home page