(data stored in ACNUC7421 zone)

EMBL: AM269962.PE11

AM269962.PE11        Location/Qualifiers
FT   CDS             join(23354..23546,23614..23794,23877..24428,24507..24801)
FT                   /locus_tag="An01g04320"
FT                   /note="Complex: part of the Erv41p-Erv46p subcomplex
FT                   associated with the COPII vesicle coat."
FT                   /note="Function: S. cerevisiae Erv46p is involved in ER to
FT                   Golgi vesicle transport."
FT                   /note="Remark: a splice site upstream of the start codon
FT                   was detected."
FT                   /note="Remark: alternative gene names for the S. cerevisiae
FT                   homolog ERV46 are FUN9 and YAL042W."
FT                   /note="Title: strong similarity to COPII vesicle coat
FT                   component protein Erv46 - Saccharomyces cerevisiae"
FT                   /note="intracellular transport vesicles"
FT                   /db_xref="GOA:A2Q8H0"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="InterPro:IPR039542"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H0"
FT                   /inference="similar to AA sequence:PIR:S51977"
FT                   /protein_id="CAK36967.1"
FT                   /translation="MPAKSRFTRLDAFAKTVEDARVRTTSGGVITIASLLVILWLVWGE
FT                   WADYRRVVVMPELVVDKSRGEKMEIHLNVTFPRLPCELLTLDVMDVSGEQQTGVVHGIN
FT                   KVRLTSAAEGGRVIDVKALELAKHLDPDYCGECYGATAPAGASKPGCCNTCDEVREAYA
FT                   QQQWAFGKGENVEQCELEGYAERIDAQRREGCRLEGVLRVNKVVGNFHIAPGRSFTSGN
FT                   MHVHDLANFFDADLPDAEKHTMTHEIHQLRFGPQLPDELSDRWQWTDHHHTNPLDGTKQ
FT                   ETNEPGYNYMYFVKVVSTSYLPLGWDPLIETHQYSVTSHKRSLMGGDASDEGHKERLHA
FT                   ANGIPGVFVNYDISPMKVINREARPKTFTGFLTGVCAIIGGTLTVAAALDRGLYEGVSR
FT                   MKKLHSN"
     MPAKSRFTRL DAFAKTVEDA RVRTTSGGVI TIASLLVILW LVWGEWADYR RVVVMPELVV        60
     DKSRGEKMEI HLNVTFPRLP CELLTLDVMD VSGEQQTGVV HGINKVRLTS AAEGGRVIDV       120
     KALELAKHLD PDYCGECYGA TAPAGASKPG CCNTCDEVRE AYAQQQWAFG KGENVEQCEL       180
     EGYAERIDAQ RREGCRLEGV LRVNKVVGNF HIAPGRSFTS GNMHVHDLAN FFDADLPDAE       240
     KHTMTHEIHQ LRFGPQLPDE LSDRWQWTDH HHTNPLDGTK QETNEPGYNY MYFVKVVSTS       300
     YLPLGWDPLI ETHQYSVTSH KRSLMGGDAS DEGHKERLHA ANGIPGVFVN YDISPMKVIN       360
     REARPKTFTG FLTGVCAIIG GTLTVAAALD RGLYEGVSRM KKLHSN                      406
//

If you have problems or comments...

PBIL Back to PBIL home page