(data stored in ACNUC7421 zone)

EMBL: AM269962.PE12

AM269962.PE12        Location/Qualifiers
FT   CDS             complement(join(25857..28850,28915..29072,29132..29482,
FT                   29560..29575))
FT                   /locus_tag="An01g04330"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   YLR187w - Saccharomyces cerevisiae"
FT                   /db_xref="GOA:A2Q8H1"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H1"
FT                   /inference="profile:PFAM:PF00169"
FT                   /inference="similar to AA sequence:PIR:S51432"
FT                   /protein_id="CAK36968.1"
FT                   /translation="MGRSRVLSLMSVFGGSSRKDNLSQHHRTSSASLTLNNPPRRVDTP
FT                   SSDTPSPLDASPITGTPHVERRVTSRPESTLFSHNPPLLEFSQDTPPELQPIFGYLNSH
FT                   ANKLYHEGYFLKLNDLDIHGRPCADRQWVECYAQLVGTALSLWDAAALDAAEESEDVCP
FT                   TFINLADASIKMLETLPTRNQGAQSLKNILSICSAGQNRYLLHFNSFHSLTQWTAAIRL
FT                   ALFEHTSLYEAYTGSIIAGKGKGLNSIRTILDRHRYKHEDWARVRFGAGTPWRRCWFVI
FT                   TPPNEKEFQKAQKSIKKKSAYDRAPRLITGDIKFYDTKKTKKAKPIATITDAYAAYAIY
FT                   PQSRALIEQSTLVKIEGKITVHGQTESTTDGFVFVMPEVHPAVSGFEMMLRFLVPTFDT
FT                   FNLYGRPTRLIAATNHIKSIMFAFPNQRRYGYLDILDISSLMQTPGSQDWNEAEWRQQL
FT                   KEATARRMAAAGSRTSSISASKPRFRATMPNRQPNGRTMTHQRNCTSPVNQLDSNQSND
FT                   AVAPGAPRDASISPIHHSRASSDTAGFASIRRQAQAAEVSPASSAQELVARGSERPGTS
FT                   GVDDHRSTGSDRNQRLDPDDEPLGHHFRSTSPPSPVIQPPAFTHAPGEMPAMRPQPSPD
FT                   LRKANNRMSDATLTQLLAASGSMNLLGASFPSGSHETIRESNQPSPLTPNTGSDQQGAP
FT                   SLLSDTSEKRVTLQEQGPPTPEDRSSDFGPPLTLPKRSSLRLDTTKAVKRKPLPAQQIR
FT                   ESDAASVAGEPSYDDLRHTVDEEVLNWVGSRQFSLTSPDIESHQDEESIYDDASANSPD
FT                   YASTRGSVYSKRSVRSVTRPRMGVMKTVGSGPPRQDLVIGDAHYTVDEPKLELSAEIPS
FT                   IDFGPTLTYLPTTGRPNTGDTLKKSMHQRSDSNATEKQFSYQAERQHSRSPSSNVMWQP
FT                   GMTAPRPTTPGRLTAEQFVQQRSAPSPPIATHNRTLSSTPPPPRPVSGDWTNNSRPQSH
FT                   LSGSRDAPPRPRSRGANSIMNYNELSSHLSAREQEHVARMTGAPLLDISNVNKAQPTPV
FT                   NPMGLVGAIDAREREKKTIREGLSNQMVQHAIVQRQQNWQQQQMASNASAAAYNQGSHY
FT                   SLYNMPTANRTWDALNQPYRPDEPRRQSWYGQFASQQAQTPPIYQQNPPYGQHPGYSGN
FT                   ASTLHY"
     MGRSRVLSLM SVFGGSSRKD NLSQHHRTSS ASLTLNNPPR RVDTPSSDTP SPLDASPITG        60
     TPHVERRVTS RPESTLFSHN PPLLEFSQDT PPELQPIFGY LNSHANKLYH EGYFLKLNDL       120
     DIHGRPCADR QWVECYAQLV GTALSLWDAA ALDAAEESED VCPTFINLAD ASIKMLETLP       180
     TRNQGAQSLK NILSICSAGQ NRYLLHFNSF HSLTQWTAAI RLALFEHTSL YEAYTGSIIA       240
     GKGKGLNSIR TILDRHRYKH EDWARVRFGA GTPWRRCWFV ITPPNEKEFQ KAQKSIKKKS       300
     AYDRAPRLIT GDIKFYDTKK TKKAKPIATI TDAYAAYAIY PQSRALIEQS TLVKIEGKIT       360
     VHGQTESTTD GFVFVMPEVH PAVSGFEMML RFLVPTFDTF NLYGRPTRLI AATNHIKSIM       420
     FAFPNQRRYG YLDILDISSL MQTPGSQDWN EAEWRQQLKE ATARRMAAAG SRTSSISASK       480
     PRFRATMPNR QPNGRTMTHQ RNCTSPVNQL DSNQSNDAVA PGAPRDASIS PIHHSRASSD       540
     TAGFASIRRQ AQAAEVSPAS SAQELVARGS ERPGTSGVDD HRSTGSDRNQ RLDPDDEPLG       600
     HHFRSTSPPS PVIQPPAFTH APGEMPAMRP QPSPDLRKAN NRMSDATLTQ LLAASGSMNL       660
     LGASFPSGSH ETIRESNQPS PLTPNTGSDQ QGAPSLLSDT SEKRVTLQEQ GPPTPEDRSS       720
     DFGPPLTLPK RSSLRLDTTK AVKRKPLPAQ QIRESDAASV AGEPSYDDLR HTVDEEVLNW       780
     VGSRQFSLTS PDIESHQDEE SIYDDASANS PDYASTRGSV YSKRSVRSVT RPRMGVMKTV       840
     GSGPPRQDLV IGDAHYTVDE PKLELSAEIP SIDFGPTLTY LPTTGRPNTG DTLKKSMHQR       900
     SDSNATEKQF SYQAERQHSR SPSSNVMWQP GMTAPRPTTP GRLTAEQFVQ QRSAPSPPIA       960
     THNRTLSSTP PPPRPVSGDW TNNSRPQSHL SGSRDAPPRP RSRGANSIMN YNELSSHLSA      1020
     REQEHVARMT GAPLLDISNV NKAQPTPVNP MGLVGAIDAR EREKKTIREG LSNQMVQHAI      1080
     VQRQQNWQQQ QMASNASAAA YNQGSHYSLY NMPTANRTWD ALNQPYRPDE PRRQSWYGQF      1140
     ASQQAQTPPI YQQNPPYGQH PGYSGNASTL HY                                    1172
//

If you have problems or comments...

PBIL Back to PBIL home page