(data stored in ACNUC7421 zone)

EMBL: AM269962.PE13

AM269962.PE13        Location/Qualifiers
FT   CDS             join(30024..30096,30180..30337,30420..30536)
FT                   /locus_tag="An01g04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8H2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H2"
FT                   /protein_id="CAK36969.1"
FT                   /translation="MAEKAEGNESESEGKERQGERYRATQADERWRTINLLTQSKTWVL
FT                   NVVSVTSVTGLIVGSAACFLLSSFETEGEWIWSRREREDIPFERAGQMVKTKPQNNSIR
FT                   HAGWTCGSILG"
     MAEKAEGNES ESEGKERQGE RYRATQADER WRTINLLTQS KTWVLNVVSV TSVTGLIVGS        60
     AACFLLSSFE TEGEWIWSRR EREDIPFERA GQMVKTKPQN NSIRHAGWTC GSILG            115
//

If you have problems or comments...

PBIL Back to PBIL home page